KEGG   Burkholderia cenocepacia J2315: BCAM0540Help
Entry
BCAM0540          CDS       T00771                                 

Definition
(GenBank) putative serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00270  Cysteine and methionine metabolism
bcj00920  Sulfur metabolism
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01200  Carbon metabolism
bcj01230  Biosynthesis of amino acids
Module
bcj_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BCAM0540
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCAM0540
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     BCAM0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 SATase_N
Motif
Other DBs
NCBI-ProteinID: CAR54398
UniProt: B4EKI4
Position
2:597723..598661
Genome map
AA seq 312 aa AA seqDB search
MAAFEIDDIVQSLQTVRRAWREKQRRSLEPGGRDLPAREALAQIVGALKGVLFPMRLGPP
DLRQESENFHVAHALDAALNALLTQVTLELRYAARHRHADGPADNLDEVASKAVQAFAAR
LPEIRRLLDSDVLAAFHGDPAAGSVDEVLLCYPGILAMIHHRLAHELYGLGLPLLARIIA
EQAHAETGIDIHPGARIGAGFFIDHGTGVVIGETAIIGERVRVYQAVTLGAKRFPRDAAG
HLEKGLARHPIVEDDVVIYAGATILGRVTIGRGAVIGGNVWLTQDVPAGENVTQAVLRSE
ANAAPRTAARVA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggccgcattcgagatcgacgacatcgttcaatcgctgcagacggtgcgccgtgcatgg
cgcgaaaagcagcggcgctcgctcgaaccgggcgggcgcgatttgccggcgcgcgaggcg
ctcgcgcagatcgtcggtgcgctgaaaggcgtgctgttcccgatgcggctcgggccgccc
gacctgcggcaggaaagcgagaacttccacgtggcccacgcgctcgacgcggcgctgaat
gcgttgctcacgcaggtgacgctcgaattgcgctacgcggcgcgtcaccgccatgccgac
gggccggccgacaacctcgacgaagtcgcgtcgaaggccgtgcaggcgttcgccgcacgc
ttgccggagattcgccggctgctcgacagcgacgtgctggcggcgtttcacggcgatccg
gcggccggcagcgtcgacgaagtgctgctgtgctatcccggcatcctggcgatgatccac
caccggctcgcgcacgaactgtacgggctcggcctgccgctgctcgcgcggatcatcgcc
gagcaggcgcatgcggaaacgggcatcgacattcatccgggcgcgcgcatcggcgcgggc
ttcttcatcgaccacggcacgggcgtcgtgatcggcgagacggcgatcatcggcgagcgc
gtgcgcgtgtaccaggccgtcacgctcggcgcgaagcgcttcccgcgcgatgcggccggc
catctggagaaagggctcgcgcgccatccgatcgtcgaggacgacgtggtgatctatgcg
ggcgcaacgatcctcggccgcgtgacgatcgggcgcggcgcggtgatcggcggcaacgtg
tggctcacgcaggacgtgccggccggcgaaaacgtcacgcaggccgtgctgcgcagcgaa
gcgaacgccgcgccgcgcacggcggcgcgcgtcgcctag

DBGET integrated database retrieval system