KEGG   Burkholderia cenocepacia J2315: BCAM0542Help
Entry
BCAM0542          CDS       T00771                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAR54400
UniProt: B4EKI6
Position
2:599028..599960
Genome map
AA seq 310 aa AA seqDB search
MSTVASGTAALSDHAARQLANATKTVPQLSTITPRWLTHLLQWVPVEAGIYRLNQVKNPE
AVRAACTQLEDESVLPQTFVPYEEQPREYFLNAVSTVLDVHTRISDLYSSPHDQIKEQLR
LTIETIKELQESQLINNPDYGLLANVTDEQRIFPLTGAPTPDDLDELLTKVWKEPAFFLT
HPLAIAAFGRECTRRGVPPPTVSLFGSQFLTWRGIPLIPSDKVPVADGKTKILLLRVGDK
RQGVVGLYQPGVAGEQGPGLSVRFMGINNQAIASYLISLYCSLAVHSPDALAVLDDVEIA
KFHDYPDTYR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttgcaagcggcacggccgcgctgagcgatcacgccgcccgccaactagcg
aacgctaccaagaccgtcccccagctttccacgatcacgccgcgctggctgacccatctg
ctgcaatgggtgccggtcgaggccggcatctaccgcctgaaccaggtgaagaacccggaa
gccgtgcgcgccgcatgcacgcagctcgaggacgaaagcgtgctgccgcagaccttcgtg
ccgtacgaggaacagccgcgcgaatacttcctgaacgcggtgagcacggtgctcgacgtg
catacgcggatctccgatctttacagcagtcctcatgaccagatcaaggagcagctgcgc
ctgacgatcgagacgatcaaggagctgcaggaaagccagctgatcaacaaccccgactac
gggctgctcgcgaacgtgaccgacgaacagcggatcttcccgctgacgggcgcgccgacg
ccggacgatctcgacgagctgctgacgaaggtgtggaaggagccggcattcttcctcacg
cacccgctcgcgatcgccgcgttcggccgcgaatgcacgcggcgcggcgtgccgccgccg
acggtcagcctgttcggctcgcagttcctcacgtggcgcggcattccgctgattccgtcg
gacaaggtgccggtcgcggacggcaagaccaagatcctgctgctgcgcgtcggcgacaag
cgccagggcgtcgtcggcctgtatcagccgggcgtcgccggcgagcaggggccgggcctg
tcggtgcgcttcatggggatcaacaaccaggcgatcgcgtcgtacctgatctcgctgtat
tgctcgctcgcggtccattcgccggatgcgctggctgtcctcgatgacgtcgaaatcgcc
aagttccatgactatcccgacacctaccgttaa

DBGET integrated database retrieval system