KEGG   Burkholderia cenocepacia J2315: BCAM0543Help
Entry
BCAM0543          CDS       T00771                                 

Definition
(GenBank) putative aminotransferase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00450  Selenocompound metabolism
bcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BCAM0543
Enzymes [BR:bcj01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BCAM0543
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     BCAM0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CAR54401
UniProt: B4EKI7
Position
2:600019..601935
Genome map
AA seq 638 aa AA seqDB search
MPDPATLARLASEFFATPPGQATAPGLSAGSGAVGGVPSALPAAAPILASVSNPVPGGSP
LAGPGGAGTGVPGLALPQGKVPGANLAPSAPTHVLSLGNRAPALAPHAAAQNGLPDNVVS
IAPALEPRVGGAALGVPQVNAPAREGAAKASPYYFTDGSLQGWQATPQDIVVPSNGLASP
EAFGLPGDDALRALLTVHRDVPASRASGADVPRYFIDDAQAAEPHGQLHRGAHPPFDVNA
IRRDFPILQERVNGKQLVWFDNAATTHKPQAVIDRLAYFYAHENSNIHRAAHALAGRATD
AYEHARETVQRFIGASSPDEIVFVRGTTEAINLIAKTWGVQNVGEGDEIVVSHLEHHANI
VPWQQLAALKGAKLRVIPVDDSGQVLLDEYRKLLNDRTKIVSVTQVSNALGTVVPVKEIV
ELAHRAGAKVLVDGAQSISHMRVDVQALDADFFVFSGHKIYGPTGIGVVYGKRAILDDMP
PWQGGGNMIADVTFERTVFQPPPNRFEAGTGNIADAVGLGAALDYVNRVGIENIARYEHD
LLAYATSVLAPVPGVRLVGTARDKASVLSFVLKGYETEEVGQALNEEGIAVRSGHHCAQP
ILRRFGLEATVRPSLAFYNTCDEVDALVSVVRRLAARR
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgacccggcgacgctcgcgcggctcgcgtccgagttcttcgcgacgccgcccggg
caggccaccgcgcctgggctgtcggcgggcagcggcgcggtcggcggcgtgccgtcggcc
ttgcctgcggcggcgccgattctcgcgtcggtgagcaacccggtgccgggcggctcgccg
ctcgcgggcccgggcggggcgggcaccggcgtgccggggctcgcgctgccgcaaggcaag
gtaccgggcgcgaacctcgcgccgtccgcgccgacgcacgtgctgtcgctcggcaaccgc
gcacccgcgctcgcgccgcatgcggccgcgcagaacgggctgcccgacaacgtcgtatcg
atcgcacccgcgctggagccgcgcgtcggcggcgcggcgctcggtgtgccgcaggtgaat
gcgccggcacgggaaggcgcggcgaaggcgtcgccgtactacttcaccgacggttcgctg
cagggctggcaggcgacgccgcaggatatcgtcgtgccgtcgaacggcctcgcgtcgccg
gaagcgttcgggttgccgggcgacgacgcgctgcgcgcgctgctgaccgtgcatcgcgac
gtgccggcgtcgcgcgcgtcgggtgccgacgtgccgcgctacttcatcgacgatgcgcag
gcagccgagccgcacggtcagctgcatcgcggcgcccatccgccgttcgacgtgaacgcg
atccgccgcgacttcccgatcctgcaggaacgcgtgaacggcaagcagctcgtctggttc
gacaacgcggcgacgacgcacaagccgcaagccgtgatcgaccgactcgcgtacttctac
gctcacgagaactcgaacatccaccgcgcggcgcatgcactggcgggacgcgcgacggat
gcgtacgagcatgcgcgggagacggtgcagcgcttcatcggcgcatcgtcgcccgacgag
atcgtgttcgtgcgcggcacgaccgaggcgatcaacctgatcgcgaagacgtggggcgtg
cagaacgtcggcgaaggcgacgagatcgtcgtgtcgcatctcgagcatcacgcgaacatc
gtgccgtggcagcagcttgccgcgctcaagggtgcgaagctgcgcgtgattccggtcgac
gattcggggcaggtgctgctcgacgaataccggaagctgctcaacgatcgcacgaagatc
gtgtcggtcacgcaggtgtcgaacgcgctcggcacggtcgtgccggtgaaggagatcgtc
gagctcgcgcatcgcgcgggcgcgaaggtgctggtcgacggtgcgcagtcgatctcgcac
atgcgcgtggacgtgcaggcgctcgatgcggatttcttcgtgttctccgggcacaagatc
tacgggccgaccgggatcggcgtcgtgtacggcaaacgcgcgatcctcgacgacatgccg
ccgtggcagggtggcggcaacatgatcgcggacgtgacgttcgagcgcacggtgttccag
ccgccgccgaaccgcttcgaagccggcaccggcaacatcgcggatgcggtggggctcggc
gcggcgctcgactacgtgaaccgcgtcggcatcgagaacatcgcgcgctacgagcacgat
ctgctcgcgtatgcgacgagcgtgctcgcgccggtgccgggcgtgcggctcgtcggcacc
gcgcgcgacaaggcgagcgtgctgtcgttcgtgctgaagggctatgaaaccgaggaagtc
gggcaggcgctgaacgaagagggcatcgcggtgcgctcggggcaccactgcgcgcaaccg
atcctgcggcgcttcgggctcgaagccacggtgcggccgtcgctcgcgttctacaacacg
tgcgatgaagtcgatgcgctggtgagtgtcgtcaggagactggcggcgcggcgttga

DBGET integrated database retrieval system