KEGG   Burkholderia cenocepacia J2315: BCAM0544Help
Entry
BCAM0544          CDS       T00771                                 

Definition
(GenBank) putative acetylglutamate kinase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00220  Arginine biosynthesis
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01130  Biosynthesis of antibiotics
bcj01210  2-Oxocarboxylic acid metabolism
bcj01230  Biosynthesis of amino acids
Module
bcj_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BCAM0544
Enzymes [BR:bcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     BCAM0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: CAR54402
UniProt: B4EKI8
Position
2:complement(602011..602895)
Genome map
AA seq 294 aa AA seqDB search
MFPDPDTPTRRVAGLARSLPFMQALHGQTVVIVDGGAASDVHTRSAFAQDVALLALTGIH
PIVIQSIPTASGAQSVHATHAAMAGVNHELVRLIGSHGARAIGVDGHDGGLLVASAESGH
ANTSEVARFDVTALNAFLDNGLVPVVMPIAPDDAGRDCLLRPERLGSVLAQHTCAVSLVM
MVDKGLLRELGELAGLYGITELEQWLAEHPAADAAPCVRDALDALAHGVQNVHLADIGQP
ESLIDELLTDEGSGVVFCRRGNTDLLSEIRRYFADSACVLRDGFSVERKPVVRF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttcccagaccctgacactcccactcgacgcgtggccggcttggcccgctcactgccg
ttcatgcaggcgctgcacggacagaccgtcgtcatcgtcgacggtggtgccgccagcgac
gtccacacgcgctcggccttcgcgcaggatgtcgcgctgctcgcgctcaccggcatccat
ccgatcgtgatccaaagcattccgactgcgtccggcgcgcaatcggtccacgcgacacac
gccgccatggccggcgtcaaccatgaactcgtgcgcctgatcggcagccacggcgcgcgg
gcaatcggcgtcgacggtcacgacggcggcctgctggtcgccagcgccgaatccggccac
gcgaacacgagcgaggtcgcgcggttcgacgtcaccgcattgaatgcgtttctcgacaat
ggactggtgcccgtcgtgatgcccatcgcaccagacgacgcgggccgcgactgcctgctg
cgccctgaacggctcggcagcgtgctcgcgcaacacacgtgcgccgtctcgttggtgatg
atggtcgacaaagggttgctgcgcgaactcggcgagctggccgggctgtacggcatcacg
gagcttgagcaatggctcgccgagcatccggccgccgatgcggcgccgtgcgtgcgggac
gcgctcgatgcgctcgcgcacggcgtgcagaacgtccatctcgccgatatcgggcaaccc
gaatcgttgatcgacgaactgttgacggacgaaggatcgggcgtggtgttctgccggcgc
ggcaacaccgatctgctgtcggaaatccgtcgttacttcgccgattcggcgtgcgtgctg
cgcgacgggttcagcgtcgagcggaagccggtcgtgcggttttga

DBGET integrated database retrieval system