KEGG   Burkholderia cenocepacia J2315: BCAM0546Help
Entry
BCAM0546          CDS       T00771                                 

Definition
(GenBank) hypothetical protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_rich_CPXG
Motif
Other DBs
NCBI-ProteinID: CAR54405
UniProt: B4EKJ1
Position
2:complement(604233..605462)
Genome map
AA seq 409 aa AA seqDB search
MSQMLALRRDEPAALVDLVIASFDRTFAHATFIDAAIDLMDDIAFANVAAEAWRRVVEGA
WNARLANVLSSVALRSPQVFSDHWDVLLDVVVPRHSPRMHCAEYAWRALDAATIDAWRRR
LAQAPAVDDAARARAVALLHSRQPAAVLDAVARLFPDDPEQAANWLMSAGYTLEHGTLRA
LHGDSPLHIDFGRALRAPALRDMPKWKREIQANHPTWQAGESRRSNAHFGGVSPHRCGLC
HQPLHRLLTLPQPIEAGIDSTTPVSFATCLACLGWESDGPLFYRHDESGHAVAHPSQRHD
AAIEPDYPASPFVESDVDVFAAPARWAWQEWGESNGRQNLSRVGGPPSWVQSAWYPDCPD
CGRKMRFAMQLDSELPQVDGGEWLWGSGGANYTFWCAPCRTSAHLWQCT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagatgctggcactgcggcgcgacgaaccagcggcactcgtcgatctcgtgatc
gcgtcgttcgatcgcacgttcgcgcatgcgacgttcatcgacgccgcgatcgacctgatg
gacgacatcgcgttcgcgaacgttgcagccgaagcgtggcgacgggtcgtcgaaggcgca
tggaacgcgcgactcgcgaacgtgctgtccagcgtcgcgctacgatcgccgcaggtgttt
tccgatcactgggacgtactgctcgacgtggtcgtcccccggcattcgccgcgcatgcat
tgtgcggaatacgcgtggcgggcactcgacgcggccacgatcgacgcgtggcgccggcgg
cttgcgcaagcacccgccgttgacgacgcggcgcgcgcacgcgctgtcgcactgctccat
tcacgacaaccagcagccgtgctcgatgcggtggcccggctgtttccggacgatccggag
caagccgcgaactggctcatgtcagcgggctacacgctggagcacggcacgttgcgcgca
ttgcacggcgattctccgctgcatatcgacttcggacgcgcgctgcgtgcgccggcactt
cgcgacatgccgaagtggaaacgcgagattcaggcgaatcatccgacctggcaagcaggc
gaatcccgtcggtcgaacgcgcacttcggcggcgtgtcgccgcatcgatgcggcctgtgc
catcagccgttgcatcggctgctgacgctgccgcaaccgatcgaagcgggtatcgacagc
acgacgcccgtgtcgttcgccacctgcctggcgtgcctcggttgggaaagcgacggcccg
ctgttctaccggcacgacgagtcgggtcatgcggtcgcccatccctcgcagcggcacgat
gccgcgatcgagcccgactatccggccagccccttcgtcgaatccgacgtcgacgttttc
gccgcgcccgcgcgctgggcctggcaggaatggggcgagtcgaacggcaggcagaacctc
agccgcgtcggcggtccgccgtcgtgggtgcagtccgcgtggtatcccgattgccccgat
tgcggccgcaagatgcgcttcgccatgcagctcgactccgagcttccgcaagtcgacggc
ggcgaatggctgtggggcagcggcggcgcgaactatacgttctggtgcgcgccatgccgg
accagcgcgcatctgtggcagtgcacgtaa

DBGET integrated database retrieval system