KEGG   Burkholderia cenocepacia J2315: BCAM0560Help
Entry
BCAM0560          CDS       T00771                                 

Definition
(GenBank) transport protein
  KO
K03561  biopolymer transport protein ExbB
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcj02000]
    BCAM0560
Transporters [BR:bcj02000]
 Other Transporters
  Pores ion channels [TC:1]
   BCAM0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB
Motif
Other DBs
NCBI-ProteinID: CAR54419
UniProt: B4EKK5
Position
2:619473..620189
Genome map
AA seq 238 aa AA seqDB search
MNGIPTTFIVQGALWLLVVFSVVTWTLIVVKAIQSLRSSARNRRYVSAFWAANSFHDAAA
LDGANSPVGQLAATGFDALRRADESSAHDLEHSWSRHDLLERHLRQQIHNARRREEAGLA
VLASIGSTAPFVGLFGTVFGIIHALTAITHSASASIDVVAGPIGEALVATGIGIAVAVPA
VLAYNFFVRRVKAASADLDAFATDFVTLAQKAGFRVPAAAPAAAPARRSDDTRQEAFA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtattccgaccaccttcatcgtccagggcgcgctctggctgctcgtcgtcttc
tccgtcgtcacgtggacgctgatcgtcgtgaaggcgatccagagcctgcgttcgagcgcg
cgcaaccggcgctacgtcagcgcattctgggccgcgaacagcttccacgacgcggccgcg
ctcgacggcgcgaacagcccggtgggccagctcgccgcgacgggcttcgacgcgctgcgg
cgcgccgacgagagcagcgcgcacgatctcgaacacagctggagccgtcacgacctgctc
gaacgccatctgcgccagcagatccacaacgcgcgccggcgcgaggaagcggggctcgcg
gtgctcgcgtcgatcggcagcaccgcgccgttcgtcgggctgttcggtacggtgttcggc
atcatccatgcgctgaccgcgatcacgcacagtgcgtcggcgagcatcgacgtcgtggcc
ggtccgatcggcgaagcgctcgtcgcgaccgggatcggcatcgcggtcgcggtgccggcc
gtgctcgcgtacaacttcttcgtgcgccgcgtgaaggctgcgtcggccgatctcgacgcg
ttcgcgaccgacttcgtcacgctcgcgcagaaggccggcttccgcgtgccggccgccgcg
cccgcggccgccccggcgcgccgttccgacgacacccgccaggaggcgttcgcataa

DBGET integrated database retrieval system