KEGG   Burkholderia cenocepacia J2315: BCAM0566Help
Entry
BCAM0566          CDS       T00771                                 

Definition
(GenBank) LysR family regulatory protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 EF-hand_13
Motif
Other DBs
NCBI-ProteinID: CAR54425
UniProt: B4EKL1
Position
2:626647..627576
Genome map
AA seq 309 aa AA seqDB search
MDERLRGVAEFVDVVESGSFAAAALRLGMTRSAVAKIVARLELRLGARLLQRTTRQLGLT
DEGFVYYEQCRRLLAELGETEAALDAGRREPAGRVRISVPVLFGRQCVAPVVRRLVERHP
RLEIDMSFSDRVADLVNDGFDLAVRIGELADTSALVGRKLGVQRMGICASPDYLARHGRP
SGLEALASHVGIAYSRGGQPTPWRIIGADGAVHDHRAAGRLRFDDLQAIADAAAAGAGLA
WLPCWLMAPYVRDGRLALVMDSDSVSGAEVFAVRPAARHVPSKVRVVVDALVDEIPHMLA
SDDASGERT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacggctcagaggcgtcgccgaatttgtcgacgtggtggaatcgggtagcttc
gcggcggcggcgctgcgcctcggcatgacgcgctcggccgtcgcgaagatcgtcgcgcgg
ctcgaactccggctcggcgcgcggctgctgcagcgcacgacgcgccagctcggcctgacc
gacgaagggttcgtctattacgagcagtgccggcggctgctggccgaactgggcgagacg
gaagccgcgctcgacgcgggccgccgcgagccggccgggcgcgtgcgcatcagcgtgccc
gtgctgttcgggcggcagtgcgtggcgcccgtcgtgcggcggctcgtcgagcgccatccg
cggctcgaaatcgacatgtcgttcagcgatcgcgtggccgacctcgtcaacgacggtttc
gacctggccgtgcgcatcggcgagctggccgatacgagcgcgctggtcggccgcaagctg
ggcgtgcaacgcatgggcatctgcgcatcgcccgactatctcgcgcgtcatggccggccg
tcggggctcgaggcactcgcgtcgcacgtcggcatcgcgtattcgcgcggcggacagccg
acaccgtggcggatcatcggcgcggatggcgcggtgcacgaccatcgcgcggccggccgc
ctgcggttcgacgacctgcaggcgatcgccgacgcggccgccgccggcgcgggcctcgcg
tggctgccgtgctggctgatggcgccgtacgtgcgcgacggccgcctcgcgctcgtgatg
gacagcgacagcgtgtcgggcgccgaagtgttcgcggtgcggccggcggcgcgccacgtg
ccgtcgaaggtgcgggtcgtcgtcgatgcgctggtcgacgagattccgcacatgctggcg
tccgacgacgcgagcggcgagcgtacgtga

DBGET integrated database retrieval system