KEGG   Burkholderia cenocepacia J2315: BCAM0567Help
Entry
BCAM0567          CDS       T00771                                 

Definition
(GenBank) Major Facilitator Superfamily protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: CAR54426
UniProt: B4EKL2
Position
2:627747..629054
Genome map
AA seq 435 aa AA seqDB search
MTATAPQLHAATMRRLNLRLIPFLMLLYLVAYIDRSNISVAALQMNADLGLSAEMYGLGA
GLFYVTYILFEVPSNLFLARVGARRWIARIMITWGIVAAAMSAVQTPGQLYAMRLLLGAA
EAGFTPGIIYYLSAWYPQSDRARAMSFFYIGATLASVIGLPLSGALLNLNGVLGVEGWRW
LFLLEGVPALLLGFVVLRRLPDTPAHARWLPADERAWLEATLRDAAPREHLSHGVALRRA
FGDGKVWALAAFWLLQAFGTIGLTLFLPLLVKSLSGQSSFAVGSLSALPFLFACVAMYLN
GRHSDLGGERALHLGVPMLLAGALLIAAIYTPVLPVAYALLVLAVGFNWAATPVFWAVTT
EYVSGLTAAASIALINAVANIAGLALPPVMGRIKDVTHSYDLALLLVAAALLAGGVLALR
IASRRVMPVVAGRVG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgccccgcagttgcacgccgcgacgatgcggcgcctgaacctgcgcctg
attccgttcctgatgctgctgtacctcgtcgcgtatatcgaccgctcgaacatctcggtc
gcggcgctgcagatgaacgccgacctcggcctcagcgccgaaatgtacgggctcggcgcg
gggctgttctacgtgacctacatcctgttcgaggtgccgagcaacctgttcctcgcgcgg
gtcggcgcgcgtcgctggatcgcgcggatcatgatcacgtggggcatcgtcgcggccgcg
atgagcgcggtgcagacgccggggcagctctatgcgatgcggctgctgctcggcgcggcc
gaagccggcttcacgccaggcatcatctactacctgtccgcgtggtatccgcagagcgac
cgggcgcgggcgatgtcgttcttctatatcggcgcgacgctcgcgtcggtgatcgggctg
ccgctgtccggcgcgctgctgaacctgaacggcgtgctcggcgtcgaaggctggcgctgg
ctgttcctgctcgaaggcgtgcccgcgttgctgctcgggttcgtcgtgctgcgccgcctg
ccggacacgcccgcgcacgcgcgctggctgccggccgacgaacgcgcgtggctcgaagcg
acgctgcgcgacgccgcgccgcgcgaacatctgtcgcacggcgtcgcattgcggcgtgcg
ttcggcgacggcaaggtgtgggcgctcgccgcgttctggttgctgcaggcgttcggcacg
atcggcctcacgctgtttctgccgctgctcgtgaagagtctgtcgggacagtcgagcttc
gcggtcggcagcctgtccgcgctgccgttcctgttcgcgtgcgtcgcgatgtacctgaac
ggccggcattcggatctcggcggcgaacgcgcgctgcatctcggcgtgccgatgctgctg
gccggtgcgttgctgatcgcggcgatctatacgccggtgctgcccgtcgcgtatgcgctg
ctggtgctcgcggtcggcttcaactgggccgcgacgccggtgttctgggccgtgacgacc
gagtacgtgtcgggcctcacggcggccgcgtcgatcgcgctgatcaacgcggtcgcgaac
atcgcggggctcgcgctgccgccggtgatggggcggatcaaggacgtcacgcattcgtac
gatctcgcgctgctgctcgtcgcggccgcgttgctggcgggtggtgtgctcgcgttgcgg
atcgcgtcgcggcgcgtaatgccggtcgtggcggggcgggtggggtga

DBGET integrated database retrieval system