KEGG   Burkholderia cenocepacia J2315: BCAM0957Help
Entry
BCAM0957          CDS       T00771                                 

Definition
(GenBank) putative pepstatin-insensitive carboxyl proteinase
  KO
K05998  pseudomonalisin [EC:3.4.21.100]
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bcj01002]
    BCAM0957
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.100  sedolisin
     BCAM0957
Peptidases [BR:bcj01002]
 Serine Peptidases
  Family S53
   BCAM0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Motif
Other DBs
NCBI-ProteinID: CAR54814
UniProt: B4EFA2
Position
2:complement(1060565..1062298)
Genome map
AA seq 577 aa AA seqDB search
MKRNAWFALPLPSPRRLACVAPLVFAAAAAHATTDWVDTHTKAFLTGPQLMARSAAPSLE
LAAGETTNVVVSLKLRNATQLKQLARDVNRPGSAHYRQYLTHEQFLANYAPTDAQVKSVV
DYLHKSGFTNVEVAPNRLLVSASGTAGTVKAAFNTSLVHFEYAGRSGFANTSTAQVPRAL
GDVVGSVLGLQSVARARPMLRIGNVAKPQALAAGTATGHYPKEFPGLYNATGVPTAAGVT
VGIITIGGVAQTLQDLKQFTSSNGYGTVSTQTVKTNGTGGSYTDDQDGQGEWDLDSQSIV
GSAGGQVGKLVFYMADLNAAGNTGLTQAFNRAVSDNTAKVINVSLGWCETDANADGTLDA
EEQIFTTAAAQGQTFSVSSGDEGVYECNNRGYPDGANYTVSWPASSPHVLAIGGTTLYTT
SAGAFSNETVWNEGLDSNGKLWATGGGVSTILPAPSWQSGSNRQLPDVSFDAAQSTGAYI
YNYGQLQQIGGTSLAAPIFTGFWARLLAANGTGLGFPAGNFYADIPSHPSLVRYDVTSGN
NGYQGYGYKAGTGWDLTTGFGSLNIANLNQLIKSGGF
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaacgcctggtttgcccttccccttccgtcgccccgccgcctggcgtgcgtg
gcaccactcgtgttcgccgccgctgcggcgcatgcgacgacggattgggtcgatacccac
acgaaggcctttctgaccggcccgcagttgatggcgcgcagtgcggcgccgtcgctcgaa
ctggcagccggtgaaacgaccaacgtcgtcgtcagcctgaagctgcgcaacgccacgcag
ctcaagcaactggcgcgcgacgtgaaccggcccggcagcgcgcattaccgccagtacctg
acgcacgagcaattcctcgcgaactacgcgccgaccgacgcgcaggtgaagtcggtcgtc
gactatctgcacaagagcggcttcacgaatgtcgaggtcgcgccgaaccggctgctggtc
tccgccagcggcacggccggcacggtgaaggctgcgttcaacacgtcgctcgtgcacttc
gagtacgcgggccgctcgggcttcgccaacacgtcgaccgcgcaggtgccgcgcgcactc
ggcgacgtcgtcggctcggtgctcgggctgcaaagtgtcgcgcgtgcgcggccgatgctg
cgcatcggcaacgtcgcgaagccgcaggcactcgccgccggcacggccaccggccactat
ccgaaggaattcccgggcctctacaacgcgaccggcgtgccgaccgcggccggcgtgacg
gtcggcatcatcacgatcggcggcgtggcgcagacgctgcaggacctgaagcagttcacg
tcgagcaacggctacggcacggtctccacgcagaccgtcaagaccaacggcacgggcggc
agctataccgacgaccaggacggccagggcgaatgggatctcgacagccagtcgatcgtc
ggctcggccggcggccaggtcggcaagctggtgttctacatggcggacctcaacgccgcc
ggcaacacgggcctcacgcaggcattcaaccgcgcggtgtcggacaacaccgcgaaggtg
atcaacgtgtcgctcggctggtgcgaaaccgatgcaaacgcggacggcacgctcgacgcc
gaggaacagatcttcacgacagccgccgcgcaggggcagaccttctcggtatcgtcgggc
gacgaaggcgtgtacgagtgcaacaaccgcggctatccggacggcgcgaactacacggtg
tcgtggccggcttcgtcgccgcacgtgctcgcgatcggcggcacgacgctctacacgacg
tcggccggtgcgttctcgaacgagacggtgtggaacgaagggctcgattcgaacggcaag
ctgtgggcgacgggcggcggcgtcagcacgatcctgcccgcgccgtcgtggcagtcgggc
agcaatcgccagttgccggacgtctcgttcgacgccgcgcagagcacgggcgcgtacatc
tacaactacggccagttgcagcagatcggcggcacgagcctcgccgccccgatcttcacg
ggcttctgggcccgcctgctcgcggcgaacgggaccggcctcggcttcccggccggcaac
ttctatgcggacattccgtcgcatccgtcgctcgtgcgctatgacgtcacgtcgggcaac
aacggctatcaggggtatggctacaaggccggcaccggctgggatctgaccaccggcttc
ggcagcctaaacatcgcgaacctcaaccagctgatcaagtcgggcgggttctga

DBGET integrated database retrieval system