KEGG   Burkholderia cenocepacia J2315: BCAM1264Help
Entry
BCAM1264          CDS       T00771                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00040  Pentose and glucuronate interconversions
bcj00053  Ascorbate and aldarate metabolism
bcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCAM1264
   00053 Ascorbate and aldarate metabolism
    BCAM1264
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BCAM1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAR55119
UniProt: B4EHE3
Position
2:complement(1388556..1390148)
Genome map
AA seq 530 aa AA seqDB search
MQLTGQLLIGQSAVAGQNGTLHAIAAATGAPLEPAFGGASLHDLETACALADDAFDTYRE
TSLDARAAFLDAIGRRIMALGDDLIERCVVETGLPRARIEGERGRTVGQLALFASLVRDG
GFLDARIDPARPERKPLPRVDLRLRNVAVGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VIVKAHSAHPGTSELVGRAIQQAARECGMPAGVFSLLFDASREIGQALVADPRIKAVGFT
GSRRGGVALMHIAAARPEPIPVYAEMSSINPVLLCPAALDARHDAIAPQFVASLTLGAGQ
FCTNPGLVLAVDGPALRAFESAAADAVRAVAAQTMLTPPIHASYAQGVAALRDHSAVALL
AEGVEGGRHQARAALLAASADAFIAHPELRDEVFGPASLIVRCPDTDTLHRVLKSLEGQL
TIAAHIADGDAALFAALRPTLERKAGRILVNGFGTGVEVGHAMVHGGPFPATSDTRTTSV
GARAIERFLRPVSYQDVPDALLPDAIRSSNPLHVPQRIDGVPAPREVNHG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcacaggtcagctcctgatcggccagtcggccgtcgccggacagaacggcact
ctccatgcgatcgccgccgccaccggcgcaccgctcgaaccggcgttcggcggcgcgagc
ctgcacgatctggaaacggcgtgcgcactcgccgacgacgcgttcgacacctatcgcgaa
acgtcgctcgacgcacgcgccgcgttcctcgacgcgatcggccgccgcatcatggcgctc
ggcgacgacctgatcgagcgctgcgtcgtcgaaacggggctgccgcgcgcgcgcatcgaa
ggcgaacgcggccgcacggtcggccagctcgcgctgttcgcgtcgctcgtgcgggacggc
ggttttctcgacgcccgcatcgacccggcgcgccccgaacgcaagccgctgccgcgcgtc
gacctgcgcctgcgcaacgtcgcggtcgggccggtggccgtgttcggcgcgtcgaacttc
ccgctcgcgttctcggtggccggcggcgacacggcgtcggcgctcgcggccggctgcccg
gtgatcgtcaaggcgcattccgcgcatccgggcacgtcggaactcgtcggtcgcgcgatc
cagcaggccgcgcgcgaatgcgggatgccggccggtgtgttctcgctgctgttcgacgcg
tcgcgcgagatcggccaggcgctcgtcgccgatccgcgcatcaaggcggtcggcttcacc
gggtcgcgtcgcggcggcgtcgcgctgatgcatatcgcggctgcgcgccccgagccgatc
cccgtctatgcggaaatgagctcgatcaacccggtgctgctgtgtcccgccgcgctcgac
gcacgtcacgatgcgatcgcgccgcagttcgtcgcgtcgctcacgctcggcgccggccag
ttctgcacgaacccgggcctcgtgctggcggtcgacggccccgcgctgcgcgcgttcgaa
tccgcagcggccgacgccgtacgcgccgtcgccgcccagacgatgctgacaccgcccatc
catgcgagctacgcgcaaggcgtcgcagcgctgcgcgatcactcggccgtcgcgctgctg
gccgaaggcgtcgaaggcggccgccatcaggcgcgcgcggcgctgctcgcagcctctgcg
gacgcattcatcgcccaccccgagttgcgcgacgaagtgttcggtcccgcgtcgctgatc
gtgcgctgcccggacaccgacacgctgcatcgcgtgctgaaatcgctcgaaggccagttg
acgatcgccgcacacatcgccgacggcgacgcggcgctgttcgccgcgctgcgtccgacg
ctcgaacgcaaggccggccgcattctggtcaacggcttcggcacgggcgtcgaggtcggc
catgcgatggtgcacggcggcccgttcccggcgacgtccgatacgcgcacgacgtccgtc
ggcgcgcgcgcgatcgagcgcttcctgcggcccgtgtcgtaccaggacgtgccggacgcg
ctgctgccggacgcgatccgcagcagcaatccgctgcacgtgccgcaacgcatcgacggc
gtgcccgccccgcgcgaggtgaaccatggctga

DBGET integrated database retrieval system