KEGG   Burkholderia cenocepacia J2315: BCAM1309Help
Entry
BCAM1309          CDS       T00771                                 

Gene name
ggt2
Definition
(GenBank) gamma-glutamyltransferase precursor 2
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00430  Taurine and hypotaurine metabolism
bcj00460  Cyanoamino acid metabolism
bcj00480  Glutathione metabolism
bcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BCAM1309 (ggt2)
   00460 Cyanoamino acid metabolism
    BCAM1309 (ggt2)
   00480 Glutathione metabolism
    BCAM1309 (ggt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bcj01002]
    BCAM1309 (ggt2)
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BCAM1309 (ggt2)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BCAM1309 (ggt2)
Peptidases and inhibitors [BR:bcj01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BCAM1309 (ggt2)
CD molecules [BR:bcj04090]
 Proteins
  BCAM1309 (ggt2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CAR55165
UniProt: B4EHU9
Position
2:1442252..1443973
Genome map
AA seq 573 aa AA seqDB search
MTTLNRFKSSAAVLATVAGIGFLPNAPAYAKGPQPAVLTSSAVAVADKYSADAAERIFKE
GGNAIDAAVAIAFTLAVTYPEAGNIGGGGFMTIYKDGKPYFIDYRERAPLAATKDMYLDK
DGNVVKGMSLYGPRAVGVPGTVAGMWEAQKRFGKLKWKQVLAPAIHYARDGFVVDEQLAQ
RGVDASKEFGGKTNFDKYFSGLKAGANFKQPDLADVLTRIADGGAEGFYKGKTAELIAAS
MKTGDGNGLITTEDLAQYRAVWRQPVQAKWNGYDVITAPPPSSGGIGLVQLLKMKADLKQ
DFEGVKLNSPQYIHLVAEIEKRVFADRAQYLGDPDFYKVPIAQLTDDAYIAKRAAEVNPK
EPSDTKSVQPGLGTTMPEKAETTHFSVVDKWGNAVSNTYTINGYFGSGVIADGTGIVLND
EMDDFSAKPGVANMFGVVGSDANAIEPKKRPLSSMSPTIMTKDGKVSLVIGTPGGSRIFT
SIFQVINNIYDFKMPLKEAVGAMRFHHQLLPPNTIFWEPYHPIEGELAKQIEARGYTLKG
QDFSGDIQVIKIDGKTPEAMADPRGRGVTRIIR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgactacgctgaatcgcttcaaatcatccgctgccgtgctggcgacggtggccggcatc
ggcttcctgccgaacgcgcccgcttacgcgaaggggccgcagcccgcggtcctgacgagt
tccgcggtggcggtggccgacaagtacagcgcggatgccgcggagcggatcttcaaggag
ggcggcaatgcgatcgacgcggccgtcgcgatcgcgttcacgctcgccgtcacgtacccg
gaagccggcaacatcggcggcggcggcttcatgacgatctacaaggacggcaagccgtac
ttcatcgattaccgcgagcgcgcgccgctcgccgcgacgaaggacatgtacctcgacaag
gacggcaacgtcgtcaagggcatgagcctgtacggcccgcgcgcggttggcgtgccgggc
acggtggcgggcatgtgggaagcgcagaagcgcttcggcaagctgaagtggaagcaggtg
ctcgcgccggcgatccactatgcgcgcgacggcttcgtcgtcgacgagcaactggcgcag
cgcggcgtcgacgcgtcgaaggagttcggcggcaagaccaacttcgacaagtacttttcc
gggctgaaggccggcgcgaacttcaagcagcccgatctcgccgacgtgctgacgcgcatc
gcggacggcggcgccgaaggtttctacaagggcaagacggccgaactgatcgccgcatcg
atgaagacgggcgacggcaacgggctgatcacgaccgaggatctcgcgcagtaccgcgcg
gtgtggcgccagccggtgcaggcaaagtggaacggctatgacgtgatcaccgcgccgccg
ccgagctcgggcggcatcggtctcgtgcagttgctgaagatgaaggccgacctgaagcag
gacttcgagggcgtgaagctcaactcgccgcagtacatccacctcgtcgcggaaatcgag
aagcgcgtgttcgccgatcgcgcgcagtatctcggcgaccccgacttctacaaggtgccg
atcgcgcagctgaccgacgacgcgtacatcgcgaagcgcgcggccgaggtcaacccgaag
gagccgtcggacacgaagagcgtgcagccgggcctcggcacgacgatgccggagaaggcc
gaaacgacgcacttctcggtggtcgacaagtggggcaacgcggtgtcgaacacgtacacg
atcaacggctatttcggctcgggcgtgatcgccgacggcacgggcatcgtgctgaacgac
gagatggacgacttctccgcgaagccgggcgtcgcgaacatgttcggcgtggtcggcagc
gacgcgaacgcgatcgaaccgaagaagcgcccgctgtcgtcgatgtcgccgacgatcatg
acgaaggacggcaaggtgtcgctggtgatcggcacgccgggcggctcgcgcatcttcacg
tcgatcttccaggtgatcaacaacatctacgacttcaagatgccgttgaaggaagcggtc
ggcgcgatgcggttccatcaccagctgctgccgccgaacacgatcttctgggagccgtac
catccgatcgaaggcgaactcgcgaagcagatcgaggcacgcggctatacgctgaagggg
caggatttcagcggcgacatccaggtcatcaagatcgacggcaagacgccggaggcgatg
gccgatccgcgcggacggggcgtgacgcggatcattcgttga

DBGET integrated database retrieval system