KEGG   Burkholderia cenocepacia J2315: BCAM1615Help
Entry
BCAM1615          CDS       T00771                                 

Gene name
bphI
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00362  Benzoate degradation
bcj00621  Dioxin degradation
bcj00622  Xylene degradation
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
bcj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAM1615 (bphI)
   00622 Xylene degradation
    BCAM1615 (bphI)
   00621 Dioxin degradation
    BCAM1615 (bphI)
Enzymes [BR:bcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     BCAM1615 (bphI)
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     BCAM1615 (bphI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: CAR55471
UniProt: B4EK78
Position
2:1798137..1799168
Genome map
AA seq 343 aa AA seqDB search
MSLAGKKITVHDMSLRDGMHPKRHQITLDQMRDIARGLDAAGVPLIEVTHGDGLGGASVN
YGFPAHTDEAYLSAVIPELKQARVSALLLPGIGTVEHLRMAHALGVGTIRVATHCTEADV
SEQHIGLARTLGLDTVGFLMMAHMSSPAQLVVQAKLMESYGANCIYITDSAGHMLPDDVT
ARIGQVRDALKPETELGFHGHHNLAMGVANSVAAVAAGANRIDAAAAGLGAGAGNTPMEV
FVAVCDRMGIETGVDVFAISDVAEDLVVPIMDAPIRLDRDALTLGYAGVYSSFLLFAKRA
EAKYGIPARDILVELGRQRLVGGQEDMIEDAALTMVRAREVAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttgcaggcaagaagatcaccgtccacgacatgtcgctgcgcgacgggatgcac
ccgaagcgccaccagatcacgctcgaccagatgcgcgacatcgcgcgcgggctcgacgcg
gccggcgtgccgctgatcgaggtcacgcacggcgacggcctcggcggcgcgtcggtcaac
tacgggtttcccgcgcacaccgacgaggcgtacctgagcgccgtgattccggagctgaaa
caggcccgggtgtccgcgctgctgctgcccggcatcggcaccgtcgagcacctgcgcatg
gcgcacgcactcggcgtcggcacgatccgcgtcgcgacgcactgcaccgaggccgacgtg
tccgagcagcatatcggcctcgcacgcacgctcgggctcgacacggtcggcttcctgatg
atggcgcacatgtcgtcgccggcacagctcgtcgtacaggcgaagctgatggagtcgtac
ggcgcgaactgcatctacatcaccgattcggccggccacatgctgcccgacgacgtgacc
gcgcgaatcggccaggtgcgcgacgcgctgaagccggagacggagctcggcttccacggc
caccacaacctcgcgatgggcgtcgcaaattcggtcgcggcggtcgccgccggcgcgaac
cggatcgacgcggcggcggccggcctcggcgccggcgcgggcaacacgccgatggaagtg
ttcgtcgcggtgtgcgaccggatggggatcgaaacgggcgtcgacgtattcgcgatttcc
gacgtcgccgaggatctcgtcgtgccgatcatggatgcgccgatccgtctcgaccgcgac
gcgctgacgctcggctatgcgggcgtctactcgtcgttcctgctgttcgcgaagcgtgcg
gaagcgaagtacgggattccggcgcgcgacatcctcgtcgagctgggccgtcagcggctc
gtcggcgggcaggaagacatgatcgaggatgcggcgctgacgatggtgcgggcgcgggag
gtggcggcgtag

DBGET integrated database retrieval system