KEGG   Burkholderia cenocepacia J2315: BCAM2261Help
Entry
BCAM2261          CDS       T00771                                 

Definition
(GenBank) putative amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00970  Aminoacyl-tRNA biosynthesis
bcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCAM2261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bcj03029]
    BCAM2261
Enzymes [BR:bcj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BCAM2261
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BCAM2261
Mitochondrial biogenesis [BR:bcj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BCAM2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAR56120
UniProt: B4EGX7
Position
2:2539487..2540845
Genome map
AA seq 452 aa AA seqDB search
MSAAPSMRSALALAAGVRSGRVSAESLVQTVLADIAARDDAINACARTFDERARRDALRV
DRLVRDGDDPGPLAGVPFLVKWNVDVAGYPTVAGSPARAALPPASADAATVARLRAAGAV
PIGATHMDELACGATGVNPHYGAVHLPADPTRMTGGSSSGSAAAVAAGYVPLALGSDTNG
SIRAPAALCGVWGFRPGDGRLSRAGCLPYAASLDTVGGFANDIDDLAVLYDTLCEAHAPR
SNPVRDPGVPLRVAVLTGDFETHADADAQRAVRRVAACLRARESVSVGSDEVANVREAAL
VISNVELARAHSGLLDGPAALVSEHLRSRIGIGLAVPGAVYREALACRAAWRTRLEALFA
CYDVLLAAATPCAAPHFADATVDINGVALAPAKALGLLTQPISFAGLPVVSAPCFASGEL
PVGVQLIGSPSDDTACFVAARQFSAEWRAMVR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcgccttcgatgcgcagtgcgctggcattggcggcgggcgtgcgcagcggg
cgggtgagcgcggagtcgctcgtgcaaaccgtgctcgccgacatcgccgcgcgcgatgac
gcgatcaatgcctgcgcacgcactttcgacgaacgggcacggcgcgacgcgctgcgcgtc
gaccgcctcgtgcgggacggggacgacccgggccccttggcaggcgtgccgttcctcgtg
aagtggaatgtcgacgtggcgggctacccgacggtcgcgggatcgcccgcgcgcgccgcg
ttgccacccgccagcgccgacgcggcaacggtcgcacgattgcgtgcggccggcgcggtc
ccgatcggcgcaacccacatggacgaactcgcatgcggcgccaccggcgtgaatccacac
tatggcgcggtgcacctgccggccgacccgacgcgcatgacgggcggctcgtcgagcggc
tccgccgccgcggttgccgccggatacgtgccgctcgcgctaggcagcgatacgaacgga
tcgattcgcgcgccggcggcgctgtgcggcgtctggggattccgccccggcgacgggcgg
ctgtcgcgggccggctgcctgccgtatgccgcatcgctcgataccgtcggcgggttcgcg
aacgatatcgacgatctcgcggtgctgtacgacacgctgtgcgaagcccatgcgccgcgc
tcgaacccggtgcgcgatccgggcgtgccgctacgcgtcgccgtgctgactggcgatttc
gaaacacatgccgatgcggatgcgcaacgcgccgtccggcgcgtggccgcctgcctgcgg
gcgcgcgaatcggtgtctgtcggcagcgacgaagttgcgaacgtgcgcgaagcggcgctc
gtgatctcgaatgtggagctggcacgcgcccatagcgggttgctcgacgggccggcggca
ctcgtatccgaacacctgcgctcgcgcatcggaatcggcctcgccgtccccggcgccgtg
tatcgcgaggcgctcgcctgccgtgccgcgtggcgcacgcgcctcgaagcgctgttcgcg
tgctacgacgtcctgctggccgctgcgacgccgtgcgcggcgccgcacttcgccgacgca
accgtcgatatcaacggcgtcgcgctcgcccccgcgaaggcgctcggcctgctcacgcaa
ccgatttcattcgcggggctgccggtcgtcagcgcaccgtgcttcgcgtcgggtgaactg
ccggtcggcgtgcagttgatcggctcgcccagcgacgacaccgcgtgcttcgtcgccgcg
cggcaattctcggccgaatggcgcgcgatggttcgttag

DBGET integrated database retrieval system