KEGG   Burkholderia cenocepacia J2315: BCAM2650Help
Entry
BCAM2650          CDS       T00771                                 

Definition
(GenBank) putative short-chain dehydrogenase/reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00061  Fatty acid biosynthesis
bcj00650  Butanoate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
bcj01200  Carbon metabolism
bcj01212  Fatty acid metabolism
Module
bcj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCAM2650
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BCAM2650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcj01004]
    BCAM2650
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BCAM2650
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     BCAM2650
Lipid biosynthesis proteins [BR:bcj01004]
 Fatty acid synthase
  Component type
   BCAM2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: CAR56514
UniProt: B4EKD5
Position
2:2999101..3000303
Genome map
AA seq 400 aa AA seqDB search
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARIS
AAFGSGADTLGVFFERAGSETKPGTAGWYNSAAFEKFATEKGLYARSINGDAFSDKVKQV
TIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPVGKAVTFRGLDTDKEVIREVS
LEPATQEEIDGTVAVMGGEDWQMWIDALADAGVLADGAKTTAFTYLGEQITHDIYWNGSI
GEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGT
HEGCIEQVYGLLKDSLYGATPHVDEEGRLRADYKELDPQVQNQVVAMWDKVTNENLYEMT
DFAGYKTEFLRLFGFEIAGVDYDADVNPDVKIPGIIDTTV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtgcgtggcttcatctgcgtgacgactcatcccgtcggctgc
gaagccaacgtcaaggaacagatcgactacgtgacttcgcacggcccgatcgccaatggc
ccgaaaaaggtgctcgtgatcggcgcgtcgaccggctacggcctcgccgcccggatctcg
gccgcattcggctcgggcgcggacacgctcggcgtgttcttcgagcgtgccggcagcgag
acgaagccgggcacggccggctggtacaacagcgccgcgttcgagaaattcgccacggaa
aaggggctgtatgcgcgcagcatcaacggcgacgcgttctccgacaaggtcaagcaggtc
acgatcgacaccatcaagcaggatctcggcaaggtcgatctggtcgtctacagcctcgcg
gcgccgcgccgcacgcatccgaagacgggcgaaaccatcagctcgacgctcaagccggtc
ggcaaggccgtcacgttccgcggcctcgacaccgacaaggaagtgatccgcgaagtctcg
ctcgaaccggcgacgcaggaagagatcgacggcaccgtcgcggtgatgggcggcgaggac
tggcagatgtggatcgacgcgctggccgacgccggcgtgctggccgacggcgcgaagacc
accgcgttcacgtacctcggcgagcagatcacgcacgacatctactggaacggctcgatc
ggcgaagcgaagaaggatctcgacaagaaggtgctgtcgatccgcgacaagctggccgcg
cacggcggcgatgcgcgcgtgtcggtgctgaaggccgtcgtcacgcaggccagctcggcg
atcccgatgatgccgctgtacctgtcgctgctgttcaaggtgatgaaggaaaagggcacg
cacgaaggctgcatcgagcaggtgtatgggctcctgaaggacagcctgtacggcgcgacg
ccgcacgtcgacgaagaaggccgcctgcgcgcggactacaaggaactcgatccgcaagtg
cagaaccaggtcgtcgcgatgtgggacaaggtcacgaacgagaacctgtacgagatgacg
gacttcgcgggctacaagaccgagttcctgcgcctgttcggcttcgagatcgccggcgtc
gactacgacgcggacgtgaacccggacgtgaagatcccgggcatcatcgacacgacggtc
tga

DBGET integrated database retrieval system