KEGG   Burkholderia cenocepacia J2315: BCAS0045Help
Entry
BCAS0045          CDS       T00771                                 

Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00450  Selenocompound metabolism
bcj00970  Aminoacyl-tRNA biosynthesis
bcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BCAS0045
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCAS0045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcj01007]
    BCAS0045
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcj03016]
    BCAS0045
Enzymes [BR:bcj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BCAS0045
Amino acid related enzymes [BR:bcj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BCAS0045
Transfer RNA biogenesis [BR:bcj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BCAS0045
 Prokaryotic type
   Other AARSs
    BCAS0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1f zf_UBZ
Motif
Other DBs
NCBI-ProteinID: CAR56977
UniProt: B4EQF9
Position
3:50718..52313
Genome map
AA seq 531 aa AA seqDB search
MPIDTIRDPRHYLLVPAMPAPNGRLHLGHIAGPYLRLDMLARHLRSRGEVARIACASDPY
DSYIPLRAGQAGIDAAALARQSCAGIVDDLAAMNIDVDLFVDPLGDAHHDAYLAAHDGLV
ARLAAQRRVSTVRERMPYSAARDGYVTGSFLLGHCPQCARDVSGFFCEDCGAHFQPEDVR
EPSARWGETLAMREQDNLFFDIADPAALVAQLVGTGTAPVFLDIARRHLARDGARFRLTS
HAGWGLPYVLDGEPRTLFGHGLLFGAIRFVGDLYARRHGLRANPFDRDSDVITVNGFGID
NCVSHLVGIQAMAMADGVSKPFDRFVINHFYTLEGRKFSTSLRWAIWVEDLAARTRVPAD
AVRGFVASTNPVAGRTDFDRDAFCRFVNGPYATVRRHVAEAIGGPLAARVPTDETVRAAE
AAWRDAQRAMDFATFDPTAMAGIVERWSARFDGARAAGDLYGWTKGFALLAWPLMPALAQ
TAWRALGLRGEPNAGDFARLSSPVVTPLANFDPVTPGDLAAVLPPGMREVA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgacacgatccgcgacccgcgccactacctgctcgtccccgcgatgccggcg
ccgaacgggcgcctgcacctcggtcatatcgcgggcccgtacctgcggctcgacatgctt
gcgcgtcatctgcgcagccgcggcgaggtcgcacgcatcgcatgcgcgagcgacccgtac
gattcctacatcccgctgcgcgccgggcaggccggcatcgacgcggcggcgctcgcgcgg
cagagctgcgcgggcatcgtcgacgatctcgccgcgatgaacatcgacgtcgacctgttc
gtcgatccgctcggcgatgcgcatcacgacgcgtacctcgccgcgcacgacgggctcgtc
gcacggctggccgcgcagcggcgcgtgtcgacggtgcgcgaacgcatgccgtattcggct
gcgcgcgacggttacgtgaccggcagttttctgctgggccattgcccgcagtgcgcgcgc
gacgtgtcgggatttttctgcgaggactgcggcgcgcatttccagccggaagacgtgcgc
gaaccgtcggcacgctggggcgagacgctcgcgatgcgcgagcaggacaacctgttcttc
gacatcgcggacccggccgcgctggtcgcgcaactggtgggcaccgggaccgcgccggtg
ttcctcgatatcgcgcgccgccatctggcgcgcgacggcgcgcgtttccgcctgacgagc
catgccggctgggggttgccgtatgtgctggacggcgagccgcgcacgctgttcgggcac
gggctgctgttcggcgcgatccgcttcgtcggcgatctctacgcgcgcaggcacgggctg
cgcgccaacccgttcgatcgcgattcggacgtgatcaccgtcaacggcttcgggatcgac
aactgcgtgtcgcatctggtcggcatccaggcgatggcgatggccgacggcgtgtcgaag
ccgttcgaccgcttcgtgatcaatcatttctatacgctggaggggcgcaagttctcgacg
agcctgcgttgggcgatctgggtcgaggatctcgcggcgcgcacgcgcgtgccggccgat
gcggtgcgcggcttcgtcgcgtcgaccaatccggttgccgggcgcacggacttcgatcgc
gatgcgttctgccggttcgtgaacgggccgtacgcgacggtccggcggcatgtggccgag
gcaatcggcgggccgctcgccgcgcgcgtgccgaccgacgagacggtgcgggcagcggag
gcggcgtggcgcgacgcgcagcgcgcgatggatttcgcgacgttcgacccgacggcgatg
gccggcatcgtcgagcgctggagcgcgcgcttcgacggcgcgcgcgcggccggcgacctg
tacggctggaccaagggtttcgcgctgctcgcgtggccgttgatgccggcgctcgcgcag
accgcgtggcgggcgctcggcttgcgcggcgagccgaacgcgggcgacttcgcacggttg
tcgtcgccggtcgtcacgccgctggcgaacttcgacccggttacgccgggagatctggcg
gcggtcctgccgcccggcatgcgggaggtcgcatga

DBGET integrated database retrieval system