KEGG   Burkholderia cenocepacia J2315: BCAS0608Help
Entry
BCAS0608          CDS       T00771                                 

Gene name
bktB
Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00071  Fatty acid degradation
bcj00072  Synthesis and degradation of ketone bodies
bcj00280  Valine, leucine and isoleucine degradation
bcj00310  Lysine degradation
bcj00362  Benzoate degradation
bcj00380  Tryptophan metabolism
bcj00620  Pyruvate metabolism
bcj00630  Glyoxylate and dicarboxylate metabolism
bcj00640  Propanoate metabolism
bcj00650  Butanoate metabolism
bcj00900  Terpenoid backbone biosynthesis
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
bcj01212  Fatty acid metabolism
bcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAS0608 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCAS0608 (bktB)
   00640 Propanoate metabolism
    BCAS0608 (bktB)
   00650 Butanoate metabolism
    BCAS0608 (bktB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCAS0608 (bktB)
   00072 Synthesis and degradation of ketone bodies
    BCAS0608 (bktB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAS0608 (bktB)
   00310 Lysine degradation
    BCAS0608 (bktB)
   00380 Tryptophan metabolism
    BCAS0608 (bktB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCAS0608 (bktB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAS0608 (bktB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCAS0608 (bktB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcj04147]
    BCAS0608 (bktB)
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCAS0608 (bktB)
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAS0608 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: CAR57540
UniProt: B4EP02
Position
3:complement(664532..665725)
Genome map
AA seq 397 aa AA seqDB search
MSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTDLGAKVVAEVLSRANVPGDAVGHVVFGHV
VNTEPKDMYLARVAAINGGVAQHTPALTVNRLCGSGLQAIVSAAQTIMLGDADVAIGGGS
ESMSRAPYTVPAARFGQRMGDGKLVDMMLGALHDPFQTIHMGVTAENVAKKYDISRDAQD
ALALESHRRAARAIAEGRFKDQILPISIRTKKGEVAFDTDEHVRHDASADDFTKLKPVFA
KENGTVTAGNASGINDAAAAVLMMSADAARAQGVKPLARLVAYAHAGVDPAYMGIGPVPA
TQKALERAGLKISDLDVIEANEAFAAQACAVTQELGLDPAKVNPNGSGISLGHPIGATGA
LITVKALYELKRIGGRYALVTMCIGGGQGIAAIFENI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcagcgaaggaagtcgtggtggtgagcggtgtccgtaccgcgatcggtgat
ttcggcggcagcctgaaggatttctcgccgaccgacctcggcgcgaaggtggtcgccgaa
gtgctgtcgcgcgcgaacgtgccgggcgacgcggtcgggcacgtcgtgttcggccacgtc
gtgaacaccgagccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggcggcgtc
gcgcagcacacgccggcgttgaccgtgaaccgcctgtgcggctcgggcctgcaggcgatc
gtgtcggccgcgcagacgatcatgctcggcgatgccgacgtcgcgatcggcggcggctcg
gagagcatgagccgcgcgccgtacaccgtgccggccgcgcgcttcggccagcgcatgggc
gacggcaagctcgtcgacatgatgctcggcgcgctgcacgacccgttccagacgatccac
atgggcgtgacggccgagaacgtcgcgaagaaatacgacatctcgcgtgacgcgcaggac
gcgctggcgctcgaatcgcatcgccgcgcggcgcgcgcgatcgcggaagggcgcttcaag
gaccagatcctgccgatctcgatccgcaccaagaagggcgaagtcgcgttcgataccgac
gagcacgtgcgccacgacgcgagcgcggacgatttcacgaaactcaagccggtgttcgcg
aaggagaacggcaccgtgacggccggcaacgcgtcgggcatcaacgacgccgccgccgcc
gtgctgatgatgagcgcggacgccgcgcgcgcgcagggcgtgaagccgctcgcccgcctc
gtcgcgtatgcgcacgcgggcgtcgatccggcgtacatgggtatcggcccggtgccggcc
acgcagaaggcgctcgaacgcgcgggcctgaagatcagcgatctcgacgtgatcgaagcc
aacgaggcattcgcggcccaggcgtgcgcggtcacgcaggagctcggcctcgatccggcc
aaggtcaacccgaacggttcgggcatctcgctcggtcacccgatcggtgcgaccggcgcg
ctgatcacggtgaaggcgctgtacgagctgaagcgcatcggcgggcgttacgcgctcgtg
acgatgtgcatcggcggcggccaggggattgcggcgatcttcgagaacatctga

DBGET integrated database retrieval system