KEGG   Burkholderia cenocepacia J2315: BCAS0737Help
Entry
BCAS0737          CDS       T00771                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00071  Fatty acid degradation
bcj00072  Synthesis and degradation of ketone bodies
bcj00280  Valine, leucine and isoleucine degradation
bcj00310  Lysine degradation
bcj00362  Benzoate degradation
bcj00380  Tryptophan metabolism
bcj00620  Pyruvate metabolism
bcj00630  Glyoxylate and dicarboxylate metabolism
bcj00640  Propanoate metabolism
bcj00650  Butanoate metabolism
bcj00900  Terpenoid backbone biosynthesis
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
bcj01200  Carbon metabolism
bcj01212  Fatty acid metabolism
bcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAS0737
   00630 Glyoxylate and dicarboxylate metabolism
    BCAS0737
   00640 Propanoate metabolism
    BCAS0737
   00650 Butanoate metabolism
    BCAS0737
  Lipid metabolism
   00071 Fatty acid degradation
    BCAS0737
   00072 Synthesis and degradation of ketone bodies
    BCAS0737
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAS0737
   00310 Lysine degradation
    BCAS0737
   00380 Tryptophan metabolism
    BCAS0737
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCAS0737
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAS0737
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCAS0737
Enzymes [BR:bcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCAS0737
Exosome [BR:bcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAS0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAR57671
UniProt: B4EPC5
Position
3:complement(811231..812421)
Genome map
AA seq 396 aa AA seqDB search
MTTQDPIVIVGAARTPMGGFQGDLAAASASDLGAVAIRAALERANVSAERIDEIVFGCVL
PAGQGQAPARQAALKAGLPLAAGATTVNKMCGSGMKAAMFAHDLLLAGSAGVAVAGGMES
MTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYEKGRLMGTFAEDCAQAYQFTREAQD
AFAIASLTRAQRAIAEGRFVSEIAPVTVKAGKTESVVSIDEQPGKAKLDKIPTLKPAFRD
GGTVTAANASSISDGAAALVMMRRSEAERLGLTPKAVIVGHSTHADQPGLFATAPIGALR
KLSEKTGWNLRDVDLFEINEAFAVVPMAAMRDLDLPHEKVNVHGGACALGHPIGASGARV
MVTLLAALETYGLKRGVASLCIGGGEATAVAIERLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcaggatccgatcgtaatcgtgggcgcggcgcgcacgccgatgggcggtttt
cagggcgacctggcggcggccagcgcgagcgaccttggcgcggtggcgattcgcgccgcg
ctcgagcgcgcgaacgtgtccgccgagcgcatcgacgagatcgtgttcggctgcgtgctg
ccggccggccagggccaggcgccggcgcgccaggccgcgctgaaggccgggctgccgctc
gccgcgggtgcgaccacggtcaacaagatgtgcggctccgggatgaaggccgcgatgttc
gcgcacgacctgctgctggcgggttcggcgggcgtggccgtggcgggcgggatggagagc
atgacgaatgcgccgtacctgctgccgaaggcgcgcgcgggcatgcgcatgggtcatggg
caggtgctcgaccacatgttcctcgacgggctcgaggacgcgtatgaaaagggccgcctg
atgggtaccttcgccgaggattgcgcgcaggcctaccagttcacgcgcgaagcgcaggat
gcgttcgcgattgcgtcgctgacgcgggcgcagcgcgcgatcgcggaagggcgtttcgtg
tcggaaatcgcgccggtgaccgtgaaggccggcaagacggaaagcgtcgtgtcgatcgac
gagcagccgggcaaggcgaaactcgacaagatcccgacgctgaagccggcgttccgcgac
ggcggcacggtgacggccgcgaacgcctcgtcgatttcggacggcgcggccgcgctcgtg
atgatgcgtcgctcggaagccgagcgcctcggcctcacgccgaaggccgtgatcgtcggg
cattcgactcatgcggaccagcccggcctgttcgcgaccgcgccgatcggcgcgctgcgc
aagctgtcggagaaaaccggctggaacctgcgcgacgtcgacctgttcgagatcaacgaa
gcgttcgcggtggtgccgatggccgcgatgcgcgacctcgacctgccgcacgagaaggtc
aacgtgcacggcggcgcatgcgcgctcgggcatccgatcggcgcatcgggtgcgcgcgtg
atggtgacgctgctggccgcgctcgaaacgtatggtttgaagcgcggcgtcgcatcgctg
tgcatcggcggcggcgaagcgacggccgtcgcgatcgagcgcctcgcgtaa

DBGET integrated database retrieval system