KEGG   Burkholderia cenocepacia J2315: pBCA044
Entry
pBCA044           CDS       T00771                                 

Gene name
traB
Definition
(GenBank) putative TraB conjugative transfer protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
bcj  Burkholderia cenocepacia J2315
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcj02044]
    pBCA044 (traB)
Secretion system [BR:bcj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   pBCA044 (traB)
SSDB
Motif
Pfam: TrbI MTBP_C
Other DBs
NCBI-ProteinID: CAR57753
UniProt: B4EQI2
Position
pBCJ2315:complement(48385..49818)
AA seq 477 aa
MSDRNDSSAGAGTNDRIKSRQRVIMIVAMVLILAATGVGLFLSGDATPTAKPKPVVETIQ
PPGSISDRDAWRGQSDAKLLDLEQRVQRVAAEQATAKAAIDKVASDVAGQKAAEASAAAS
AAAAASAAAAASAPSGTTSATTASPATLNKPLPVGTTGRGLGGKRVLTPPGDNTALNTPI
GEGMPVSNELEIIDFDDSTDAGGVGAGPGGTGGKLEVQGFPVDARARRYKMTTSTNGGAA
GGAGGKGDVNLLPAGSFIPVAMLNGVDAPTGGQAQSDPLSVDLEAIKPANLPNGKSLDVR
GCRIVSSAWGDLSAERMMGRTQILSCIIAGHPIELEIKGKLIGEDGKEGVRGRLVTKQGQ
VLANAILAGSLGGIGQAFQQSATVTSFGGGGVAQTIDGGQVGRAAIGGGVGTAGQMLAQY
YLKAADKLFPVIETDATRTIEVSITKGVYVDAATAALFDARSTFDRSRNRNRRTRDE
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgagtgaccgaaacgattcttccgcaggggcgggcacgaacgatcgcatcaaatctcgc
caacgcgtgatcatgattgtggcgatggtgttgattcttgccgcgacgggtgtcggcttg
tttctaagcggagacgctacgccgacggctaagccgaagcctgttgttgaaacgattcaa
ccgccgggctcaataagtgatcgtgacgcgtggcggggccaatccgatgcaaagctgctc
gacctcgagcagcgagttcaacgcgttgctgccgaacaggcaaccgccaaggccgcaatc
gacaaagttgcatccgatgtcgccggccagaaagctgccgaggccagtgccgcggcgagt
gccgccgccgccgcgtctgcggcagccgctgcctctgcaccctcgggaacgacttccgcg
acgacggcgtcgccggccaccctcaacaaacctctccctgttggcacgaccggtcgaggt
ttgggtggcaagcgcgtactgacgccgccgggcgacaacaccgcactgaatacaccaatc
ggcgagggcatgcctgtgtcgaatgaactcgagatcatcgatttcgacgacagcacagac
gccggtggcgtcggtgccggccccggcggcaccggggggaagctcgaagttcaaggattt
cctgtcgacgcacgagcgcgccgctacaagatgaccacctcaaccaacggcggagccgct
ggtggtgccggtggcaaaggcgacgtcaacttgttaccggccggctccttcatcccggtt
gcgatgctcaacggcgtcgacgccccgactggcgggcaagcgcagagtgatccgctttcc
gtagaccttgaagcgatcaaaccagcgaatctcccgaacggaaagagcctcgatgttcgg
ggctgtcggatcgtatcaagcgcgtggggtgatctgtctgcagaacgcatgatgggccgc
acacaaatcttgtcgtgcattatcgccggccatccgattgagctcgaaatcaagggaaag
cttatcggcgaagacggtaaggaaggcgttcgtgggcgacttgtcacgaagcagggccag
gttctcgcgaatgcgattctggccggctcgcttggtggcatcggccaggcgttccaacag
tccgcgacggtgacgtcgttcggaggcggcggcgttgcgcagacgatcgatggcggtcag
gttggccgagccgcaatcggcggtggtgtcggaactgccggccagatgctcgcgcagtac
tacctgaaggctgctgacaagctcttccctgtaatcgaaacggacgcaacccgaacgatc
gaagtctcgatcaccaagggcgtgtacgtcgatgcggccacggccgctctcttcgacgcg
cgttcgacgttcgaccgttcccgcaatcgcaatcggagaacccgagatgaataa

DBGET integrated database retrieval system