KEGG   Bacillus coagulans 2-6: BCO26_1630Help
Entry
BCO26_1630        CDS       T01527                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00030  Pentose phosphate pathway
bck00480  Glutathione metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
Module
bck_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bck_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCO26_1630
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCO26_1630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bck04147]
    BCO26_1630
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BCO26_1630
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BCO26_1630
Exosome [BR:bck04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BCO26_1630
  Exosomal proteins of colorectal cancer cells
   BCO26_1630
  Exosomal proteins of bladder cancer cells
   BCO26_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AEH53689
UniProt: F7Z5C1
Position
1673126..1674625
Genome map
AA seq 499 aa AA seqDB search
MQTTETPKSLFMLFGATGDLAKRKLFPSLYNLYRKGRLSEHFAVIGTARREWTDEIFRAH
IKDSVLSAREHAEQLEAFATHFYYQPHDVTDSNSYIQLKQLADELDEKYQLEGNRIFYLA
MAPEYFGTISDHLKSDGLTATNGFKRLVIEKPFGHSLESAKQLNSQIRKSFSEDQIYRID
HYLGKAMVQNIEVIRFANALFEPLWNNRYISNIQITSSEMLGVEERARYYEASGALRDMV
QNHMLQMVALLAMEPPISLTTNEIRSEKVRVLRALRSIEGKDVPAYFVRGQYGPGEMGGK
KVPGYREELNVAPDSRTETFVAGKLMIDNFRWAGVPFYIRTGKRMAAKSTKIVVQFKDIP
MNLYYNTNHELNPNLLVIHIHPEEGISLHLNAKKPGQHMETTPVQLSFASSSKNGINTPE
AYEKLIHDCLMGDATNFTHWDEVALSWSFVDNISKVWENKPISFPNYKSGSMGPKAADEL
LEKDGFFWWPVEDLEVGNC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaaccgagacaccgaaatcgttatttatgctttttggcgcaacaggtgatctg
gcgaagcgcaagctgtttccttccctgtacaatttataccggaaaggcaggctgtcagag
catttcgccgtgatcggcacggcaagaagagaatggacggatgaaatcttccgtgcgcat
atcaaagattccgttctgagcgcgagagaacatgctgaacagcttgaagcgtttgccacc
catttttactatcagccgcatgatgtgacagacagcaactcatacatacagttgaagcaa
ttggcggatgaactggatgaaaagtaccaactggaaggcaaccgcatcttctatttggcg
atggccccggaatatttcgggacgatttcggaccatctgaaaagtgacgggcttaccgct
acaaacgggtttaaacggcttgttattgaaaaacctttcgggcacagcctcgaatcagcg
aaacagctgaacagccagatccggaaatctttttcagaagaccagatttaccgaatcgac
cattatctaggcaaagcgatggtacaaaatattgaggtcatccggtttgccaatgccctg
ttcgagccgctttggaacaaccgttatatttccaacatccagattacatcaagcgagatg
ctcggcgtggaagaacgggcgcggtattacgaagcgagcggggcgctcagggatatggtg
caaaaccatatgctgcaaatggtggcgcttcttgcaatggaaccgccgatcagcctgaca
acaaacgagatccggagcgaaaaagtgcgggtgctgcgtgccttgcgctccattgaagga
aaagatgtgccggcatacttcgtgcgcggccagtacggcccgggcgaaatgggcggcaag
aaagtcccgggttaccgggaagagctgaatgtagcgccggattcccggaccgaaacgttt
gtcgctgggaaactgatgattgataatttcagatgggcgggcgtgccgttttacatccgt
accggcaaacggatggcggcgaaatcgacgaaaattgtcgtgcagtttaaagatatcccg
atgaatttgtactacaatacaaatcatgaactgaatccgaatctgcttgtcatccatatc
catccggaagaagggatttcgcttcatctgaacgccaaaaaaccgggccagcatatggaa
accacccctgtgcagctcagttttgcaagcagcagcaaaaacggcatcaatacgcccgaa
gcttatgaaaaattgatccatgactgcctgatgggcgacgcgaccaactttacccattgg
gatgaagtcgccttatcatggagctttgtcgataatatttcaaaagtgtgggaaaacaag
ccgatttcattcccgaattacaaatccggttcgatggggccgaaagcagctgatgaactg
ctggaaaaagacggcttcttctggtggccggtcgaagatctggaagtcgggaactgctga

DBGET integrated database retrieval system