KEGG   Bacillus coagulans 2-6: BCO26_2238Help
Entry
BCO26_2238        CDS       T01527                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00010  Glycolysis / Gluconeogenesis
bck00051  Fructose and mannose metabolism
bck00562  Inositol phosphate metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
bck01230  Biosynthesis of amino acids
Module
bck_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bck_M00002  Glycolysis, core module involving three-carbon compounds
bck_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_2238 (tpiA)
   00051 Fructose and mannose metabolism
    BCO26_2238 (tpiA)
   00562 Inositol phosphate metabolism
    BCO26_2238 (tpiA)
Enzymes [BR:bck01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCO26_2238 (tpiA)
Exosome [BR:bck04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCO26_2238 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCO26_2238 (tpiA)
  Exosomal proteins of melanoma cells
   BCO26_2238 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEH54296
UniProt: F7Z5W2
Position
complement(2263412..2264173)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLPEALAFVEEVKHSVPGESVVDSVICAPALFLERLVEATKGTRVK
IGAQNMHYEESGAFTGEISPVALADLHVEYVILGHSERREMFNETDEAVNKKVKAAFAHH
LTPIVCVGETLAQRENNETKQIVGSQVKAAFSGLSGDEAKQVVVAYEPIWAIGTGKSSTA
EDANEVCAYIRSAIADQFSQDVADSVRIQYGGSVKPGNIKEFMEQPDIDGALVGGASLDP
QSYLQLLEAVSHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtaaaccgatcattgcggggaactggaaaatgaataaaaccttgccggaagcgctg
gcttttgtcgaagaggtaaaacattcggtacctggcgaatctgttgtcgacagcgtcatc
tgtgcgcctgcgctctttttggaacgcctggtggaagcaacaaaaggcacccgcgtaaaa
attggcgcccaaaacatgcactatgaagaaagcggtgcttttacaggcgagatcagcccg
gttgcactcgcggatttgcatgttgaatatgtcatcctgggacactctgaacgccgtgaa
atgtttaatgaaacggatgaagcagtcaataagaaagtgaaagctgcttttgcccatcat
ttaacaccaatcgtatgcgtgggagaaacactggcacaacgggaaaacaatgaaacaaaa
caaatcgtcggttcacaggtaaaagctgctttttccgggctttccggcgacgaggcaaaa
caggttgtcgttgcctatgaacctatctgggcaatcggaacaggcaaatcttcgactgcc
gaagatgccaacgaagtttgtgcctatatccgtagtgccatcgcggaccaattcagccag
gatgttgctgacagtgtccgaattcaatacggcggcagtgtaaaacccggcaacattaaa
gaattcatggaacaaccggatattgacggtgcattagtgggcggcgcaagccttgacccg
caatcttatttgcaattattggaggcggtaagccatgagtaa

DBGET integrated database retrieval system