KEGG   Bacillus coagulans 2-6: BCO26_2625Help
Entry
BCO26_2625        CDS       T01527                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00010  Glycolysis / Gluconeogenesis
bck00071  Fatty acid degradation
bck00350  Tyrosine metabolism
bck00625  Chloroalkane and chloroalkene degradation
bck00626  Naphthalene degradation
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_2625
  Lipid metabolism
   00071 Fatty acid degradation
    BCO26_2625
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCO26_2625
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCO26_2625
   00626 Naphthalene degradation
    BCO26_2625
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCO26_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Methyltransf_31 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AEH54683
UniProt: F7Z6N5
Position
complement(2699125..2700147)
Genome map
AA seq 340 aa AA seqDB search
MRAAVVSSDKQKLVEVKDVQLRPLEYGEALVDIEYCGVCHTDLHVAKGDFGDVPGRILGH
EGVGIVREVADGVTSLKVGDRVSVAWFFEGCGHCEYCLTGNETFCRNVKNAGYSVDGAMA
EQCIVKADYAVKVPEGLDPRQATSITCAGVTTYKAIKVADVKPGEWIAIYGAGGLGNLAV
QYAKHVFNAKVIAVDINDDKLSLAKEVGADLTFNSKTDGDPAEWIQKEVGGAHAAVVTAV
SKQAFNQAVHSVRPVSKVVAVGLPPETMDLEIVKTVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVHTRRLEEVGDVFKEMEEGRIQGRMVLDMSLK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagtcgtcagttctgataagcaaaaactggtagaggtcaaagatgtgcag
ttgcgtccacttgaatatggggaagctttggtggatatcgaatactgcggtgtctgtcat
acggatctgcatgtggcaaagggcgactttggcgatgtgccgggacgcattctcggccat
gaaggggtcggcattgtcagggaagtcgcggatggtgtcacttctcttaaagtgggcgat
cgtgtaagcgttgcctggttttttgaaggctgcgggcattgtgaatactgtttaacggga
aatgaaacattttgccgtaatgtgaaaaatgcaggctacagtgtcgacggggctatggca
gagcaatgcattgtcaaagcggattacgccgtaaaagtgccggaagggctggatccaagg
caggcgacaagcattacttgtgccggtgtaaccacttataaagctattaaagtcgcagat
gtgaagccgggcgaatggattgccatttatggagcagggggcctcgggaaccttgctgtc
cagtacgccaaacatgtatttaatgcgaaagtcattgcggtcgatatcaatgacgacaaa
ctttcactggcaaaagaagtcggtgctgatctcacctttaattccaaaacggatggcgat
ccggctgagtggattcagaaagaagttggcggcgcgcatgctgcagtggtaacggctgtt
tcgaaacaggcattcaaccaggctgtccactccgtacggccggtgtcaaaagtcgttgct
gtcgggctccctccggaaacaatggatcttgaaattgtgaaaacagtccttgacgggata
gaagtcgtcgggtctttggttggcacaagaaaagaccttgaggaagcttttatgttcggt
gcggaaggaaaagtcgtcccggttgtgcacacgcgcagactggaagaagtgggagatgtg
tttaaagaaatggaagaaggcagaatacagggcaggatggtcctggatatgtcgttgaaa
taa

DBGET integrated database retrieval system