KEGG   Bacillus coagulans 2-6: BCO26_2818Help
Entry
BCO26_2818        CDS       T01527                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00520  Amino sugar and nucleotide sugar metabolism
bck00550  Peptidoglycan biosynthesis
bck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BCO26_2818
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCO26_2818
Enzymes [BR:bck01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BCO26_2818
Peptidoglycan biosynthesis and degradation proteins [BR:bck01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BCO26_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AEH54874
UniProt: F7YZW3
Position
complement(2898481..2899536)
Genome map
AA seq 351 aa AA seqDB search
MISMPLPNGRVKKLRASYYLMGAMLGRFKKAVIGLPGGCHLGPRPIDQHIKGFEALGAKV
TNEQGAIYLRADELKGARIYLDVVSVGATINIMLAAVKAKGKTVIENAAKEPEIIDVATL
LTNMGAKIKGAGTDVIRIEGVDHLSGCRHTIIPDRIEAGTFMILAAAAGEGVLVDNVIPH
HLESLTAKLREMGIPVETGDEQIFIGKADKLKPVDIKTLVYPGFPTDLQQPFTTLLTRAE
GTSIVTDTIYSARFKHIDELRRMSANIKVEGRSAIVNGPARLQGAKVKASDLRAGAALVI
AGLMAEGVTEVTGVEHIDRGYSCLVEKLTGLGAAVWREGMSEKEMEHLNHS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgatgccgctgcccaatggcagggtgaagaaactgcgtgcctcatattacttg
atgggcgcgatgctcggaaggttcaaaaaagctgtcatcgggctgccgggcgggtgccat
ctcggaccgcggccgatcgaccagcatattaaaggctttgaagcattgggcgcaaaagtg
acaaatgagcagggtgccatctatttaagggcggatgaattgaaaggtgcccgtatttat
ctggacgttgtcagtgtcggagcaacgatcaatattatgctggctgccgtcaaagcaaag
ggaaagacagtcattgaaaacgctgcaaaagaaccggaaatcattgacgtagccacactt
ttgacgaatatgggcgcaaaaattaaaggtgcgggaacagatgtcatccggattgaaggc
gtggaccatttgagcggctgccggcatacgattatcccggacagaattgaagctggtacg
tttatgatcctggcggcggcggcgggtgaaggggtactggttgacaatgtcattcctcat
catctcgagtcgctgaccgcaaagctcagggaaatgggcataccggtggaaaccggggat
gaacagatttttatcggaaaagcagacaagctgaaaccggttgatattaaaacactcgtt
tatccggggtttccgacagatctgcaacaaccgttcaccacgcttttgacaagggcagaa
ggcacgtctatcgtaaccgatacaatctattccgcccgctttaaacatattgacgagttg
cggagaatgagcgccaatattaaagtggaaggacggtctgcgattgtcaacggcccggcc
cggcttcagggggcaaaggtaaaagcgagtgatttgcgtgcgggtgccgcccttgtcatt
gccggcctgatggcagaaggggtgacagaagtgacaggggtcgaacatatcgaccgcgga
tacagctgcctcgtggaaaaattaaccggtcttggtgccgctgtttggcgggaaggcatg
tccgaaaaggagatggaacacctgaaccattcctag

DBGET integrated database retrieval system