KEGG   Bacillus coagulans 2-6: BCO26_2820Help
Entry
BCO26_2820        CDS       T01527                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00010  Glycolysis / Gluconeogenesis
bck00030  Pentose phosphate pathway
bck00051  Fructose and mannose metabolism
bck00680  Methane metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
bck01230  Biosynthesis of amino acids
Module
bck_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bck_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_2820
   00030 Pentose phosphate pathway
    BCO26_2820
   00051 Fructose and mannose metabolism
    BCO26_2820
  09102 Energy metabolism
   00680 Methane metabolism
    BCO26_2820
Enzymes [BR:bck01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BCO26_2820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: AEH54876
UniProt: F7YZW4
Position
complement(2900894..2901751)
Genome map
AA seq 285 aa AA seqDB search
MPLVSMTEMLNKAKEGKYAVGQFNVNNLEYAQAILMAAEEEKSPVILGVSEGAGRYMSGF
KTVVKMVEGLMEDLNVTVPVAIHLDHGSSFENAKKAIDAGFTSVMIDASHHPFDENVEIT
SKVVEYAHARGVSVEAELGTVGGQEDDVVGKGIIYADPEECKKLVDATKIDALAPALGSV
HGPYHGEPNLGFKEMEEISKITGIPLVLHGGTGIPEADIKKAISLGTAKINVNTENQIAS
AKTVREVLAADPDVYDPRKYLGPARETIKQTVIGKIREFGSNQKA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagtttccatgactgaaatgctgaataaagcaaaagaagggaaatatgcggta
gggcaattcaacgtcaataaccttgaatacgcccaggccatcctgatggctgcagaagaa
gaaaaatccccggtcatcctcggtgtttccgaaggagcaggccgttacatgagcggtttt
aaaaccgttgtaaaaatggttgaaggattaatggaagacttgaatgtcacggttccggtc
gcgatccatcttgaccatggttcaagctttgaaaatgcaaagaaagctatcgatgcaggc
tttacttctgtaatgatcgatgcttcccaccatccgtttgacgaaaacgtggaaattact
tctaaagtggtggaatatgcccatgcccgcggcgtatctgtggaagcagaactcggcact
gtcggcggccaggaagacgatgttgtcggaaaaggcatcatttatgcggacccggaagaa
tgcaaaaaactggttgacgcaaccaaaatcgatgctttggcgccggctcttggttcagtt
cacggcccttaccacggcgaaccaaaccttggcttcaaagaaatggaagaaatcagcaaa
attaccggcattccgcttgtgctccacggcgggacaggcattcctgaagctgacatcaaa
aaagccatttctttaggtactgcaaaaattaacgtgaatacggaaaaccaaattgcttcc
gcaaaaacggttcgtgaagtattggccgctgatccggatgtatacgatccgcgcaaatac
cttgggcctgcacgcgaaacgattaaacaaaccgttatcggcaaaatccgcgagttcggt
tctaaccaaaaagcatga

DBGET integrated database retrieval system