KEGG   Bacillus coagulans 2-6: BCO26_2834Help
Entry
BCO26_2834        CDS       T01527                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00071  Fatty acid degradation
bck00072  Synthesis and degradation of ketone bodies
bck00280  Valine, leucine and isoleucine degradation
bck00310  Lysine degradation
bck00362  Benzoate degradation
bck00380  Tryptophan metabolism
bck00620  Pyruvate metabolism
bck00630  Glyoxylate and dicarboxylate metabolism
bck00640  Propanoate metabolism
bck00650  Butanoate metabolism
bck00900  Terpenoid backbone biosynthesis
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
bck01212  Fatty acid metabolism
bck02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCO26_2834 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BCO26_2834 (mmgA)
   00640 Propanoate metabolism
    BCO26_2834 (mmgA)
   00650 Butanoate metabolism
    BCO26_2834 (mmgA)
  Lipid metabolism
   00071 Fatty acid degradation
    BCO26_2834 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BCO26_2834 (mmgA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCO26_2834 (mmgA)
   00310 Lysine degradation
    BCO26_2834 (mmgA)
   00380 Tryptophan metabolism
    BCO26_2834 (mmgA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCO26_2834 (mmgA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCO26_2834 (mmgA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCO26_2834 (mmgA)
Enzymes [BR:bck01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCO26_2834 (mmgA)
Exosome [BR:bck04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCO26_2834 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AEH54890
UniProt: F7YZX5
Position
complement(2915403..2916581)
Genome map
AA seq 392 aa AA seqDB search
MNTVIIDGARTPFGKFGGKLAALPASALGGIAIRHALEKAGVENGEVNEVIMGNVLQGGQ
GQLPSRQAARHAGIPWEVKTETVNKVCASGMRSVTMADQIIRLGDGEVIVAGGMESMSNA
PYFLPKARWGLKMGDVQLKDMMTHDGLICAFSGVHMGTYGNRTAEAFGLTRDFQDRWALR
SHQKALEAIHSGKFAEEIVPVEIPQGKGPALLVEQDEPPRADTTLEKLSQLPPAFDKDGT
ITAGNAPGVNDGAAALVLMSAERAAKAGLKPLAKIVAHAEVAVEAQHFPQTPGLVINEIL
KKTGRKLDDIDLFEINEAFAAVALASSKIAQLDLDKVNVNGGAVALGHPIGASGTRIILT
LAYELKRRGGGTGIAAICSGGGQGDAVMIEVQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacggtgatcatcgacggggcgcgtacgccatttgggaaattcgggggaaaactg
gctgcacttccggcgtccgcgttaggcgggattgcgatccggcatgcattggaaaaagcg
ggcgttgaaaacggggaagtaaatgaagtgattatggggaatgtcctacagggcggccag
gggcagctcccatcccggcaggcggcaaggcacgccggcattccgtgggaagtcaaaacg
gaaacggtgaataaagtgtgtgcttccggcatgaggagcgtgaccatggcggatcagatc
atccgtttgggagacggggaagtcattgtagccggcgggatggagtcgatgtcaaacgcc
ccttacttcctgcccaaggcaagatggggattgaaaatgggcgatgtccagctgaaagac
atgatgacccatgacggactcatctgcgcattttccggcgtccatatgggcacatacgga
aaccgcacggcggaagcgttcgggctgacccgcgactttcaggaccgctgggcattaaga
agccaccagaaagcattggaagccatccattccggcaagtttgccgaagagattgttccg
gtggaaatcccgcaaggaaaaggccctgcgctgcttgttgaacaggatgaaccgccgcgc
gcggatacgacgcttgaaaaactgtcccagctgccgcctgctttcgacaaagacggcacc
atcacggccggcaatgctccgggtgtgaatgacggggcggctgcacttgttttaatgagc
gctgaacgggctgcaaaagcagggttgaagccgcttgcaaagattgtggcgcatgcggaa
gtggcggtggaggcgcagcattttccgcagacgccggggcttgtgatcaacgaaatcctg
aaaaaaacaggaagaaagcttgatgacattgatttgtttgaaatcaatgaagcatttgcc
gctgtggcccttgccagcagcaaaatcgcacagctcgatttggataaggtgaatgtaaac
ggcggcgcggttgcgttaggccatccgatcggtgcaagcggcacgcgcattattttaacc
cttgcatacgaactgaaacggcgcggcggcgggaccgggatcgcagccatctgctccggt
ggcggccagggcgatgccgtcatgattgaagtgcaataa

DBGET integrated database retrieval system