KEGG   Alkalihalobacillus clausii: ABC1572
Entry
ABC1572           CDS       T00228                                 
Name
(GenBank) LacI family transcriptional regulator
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
bcl  Alkalihalobacillus clausii
Brite
KEGG Orthology (KO) [BR:bcl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bcl03000]
    ABC1572
Transcription factors [BR:bcl03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    ABC1572
SSDB
Motif
Pfam: Peripla_BP_1 Peripla_BP_3 LacI Peripla_BP_4 HTH_3 HTH_7 HTH_Tnp_ISL3 HTH_IclR HTH_AraC OmpH HTH_31 MarR_2 HTH_Tnp_4 HTH_38
Other DBs
NCBI-ProteinID: BAD64107
UniProt: Q5WHP8
Position
1693932..1694939
AA seq 335 aa
MPTIKDVALRAGVSRSTVSRVMNNQPYVDEEKRKAVKQAMKELGYLPNSSAQRLRGTETR
TIAVLVSRIVNPFFSAIVDAMDEVAAEQSYRLILCNTRGSANQELHFLQLLRTKQVDGLI
LASLVNDWETIAPYTDYGPIVICNEYPRQSDGVPVVTIDQSKAMYEATVHLLKKGYKQIA
YCNPITKTESDAVISPLAQDRYLGFCQAMEEAGMHMYGECLFLGHSLEDGRNIFKQMVCL
ANRPDAILTGSDEVAAGIIAEAKAAGWKIPDDLAIVGFDNQPHATLIEPELTTIHQPVQE
MGRAAMERMLALLRKESPPPLATYLEAPLLARKST
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgcccacaattaaagatgtggcccttcgtgctggtgtgtcacggtcaacggtttcccgt
gtaatgaacaatcagccttatgtggatgaggaaaaacggaaagccgtcaaacaagcaatg
aaggagctgggctatttaccgaattcatcggctcaacgccttaggggaacagaaacacgg
acaattgctgtccttgtttcacgaatcgtaaaccctttttttagtgcaattgtagacgcg
atggacgaggtcgctgctgaacagtcgtataggcttattttatgcaacacaagaggttct
gcaaaccaagagctccatttcttgcagcttttgcgaaccaaacaagtcgatggccttatt
cttgcttcgctcgttaatgattgggaaacgattgccccctatacggattatgggcccatt
gtcatttgcaatgaatatccacggcagtctgatggagtaccagtagtgacaattgaccag
agtaaagcgatgtacgaagcaactgtccatttgttaaaaaaaggttataagcaaattgct
tattgcaatccgatcacaaaaacggaatccgatgccgttatttcgccacttgcccaagat
cgttatttagggttttgtcaggcaatggaagaagccgggatgcacatgtatggcgaatgt
ttgtttttgggacattcccttgaggacggcagaaatatattcaaacaaatggtgtgctta
gctaaccggcctgatgccattttgacaggaagcgatgaagtggcagctggaataatcgct
gaggcaaaagctgctggctggaaaatccctgatgacttagcgattgtcggctttgacaat
caaccgcatgctactttgattgaacccgagttgacgacgattcaccagcctgtgcaggaa
atgggcagggcagcaatggaacgtatgctcgctttgttgcgaaaagagagtccaccaccg
ttagcgacatatttggaggcgccgctgttggcgcggaaatcaacttaa

DBGET integrated database retrieval system