KEGG   Bacillus clausii: ABC0235Help
Entry
ABC0235           CDS       T00228                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcl  Bacillus clausii
Pathway
bcl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABC0235
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ABC0235
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ABC0235
    1.1.1.-  
     ABC0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N HI0933_like ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: BAD62778
UniProt: Q5WLH7
Position
258845..259894
Genome map
AA seq 349 aa AA seqDB search
MRAAVWYKEKDIRVEEREPAKLGARDVKVRVAWAGICGSDLHEYLHGPVIIPKGEPDPIT
GGESPLTLGHEFAGVIEEVGTEVKSFQKGDRVVINPLFTYGNKPASVDLYDGFSFAGLAT
DGGFADFAVLPEKNVYKLPDNLTLEEGALVEPMAVAVQAVKEADFKFGQSVAVFGAGPIG
LFTIIAAKAAGASKIIVFDLSEERLEKARLVGATHTFNSGAVDPVEKVKSLVPDGVDVSF
EVAGVNATFNQSIQVAKSRGVVVVVSIFAKPIEFNPMDLTGSGVKITSTLAYEPEVFQTT
IDLMAEGALNPKGVITDRIELENIVESGFEVLTNDKRQAKILVKLSGEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagccgtatggtacaaagagaaagatatccgtgtagaggaaagagaacctgcg
aaactaggcgcccgtgatgtaaaagtgcgcgtagcgtgggctggtatttgcggaagtgat
cttcacgaatacttgcacggtccggtgattatcccaaaaggagaacctgatcctattact
ggcggcgaatcaccccttacattagggcacgaatttgccggtgtgattgaggaagtagga
acggaggttaaatcctttcagaagggggatcgtgtcgtcattaatccactctttacctac
ggaaataagcctgcttcagttgatctctatgatggtttctcgtttgctggtcttgctaca
gatggaggatttgctgattttgcagtactcccagagaaaaatgtatataaattgcctgat
aacttaacgttggaagaaggagcactcgttgagccgatggcagtggcggtgcaagcggta
aaagaagccgattttaaatttggacaatcagttgccgtctttggggcggggccaattggt
ttgtttaccattattgctgctaaggctgcaggggctagcaaaatcatcgtttttgattta
tcggaagaaaggctggaaaaagcacggcttgtcggcgccacccatacatttaattctggc
gcagtcgatcccgttgaaaaagtaaaaagccttgtcccagatggggtcgatgtaagcttt
gaagtggctggcgtaaatgcaacatttaaccagtctatccaagtagccaagtcacgggga
gtcgtcgtcgttgtttccatttttgccaaaccgattgagttcaatccaatggatcttacg
ggcagtggcgttaagattacgtccactttggcttatgaaccggaagtattccaaacgact
attgatttaatggcagagggagccttaaatccgaaaggcgttataaccgatcggattgag
ctagaaaatattgtagagtctgggtttgaagtgttaacaaacgataaacgccaggctaaa
attctcgtgaaacttagcggcgagaaataa

DBGET integrated database retrieval system