KEGG   Bacillus clausii: ABC0732Help
Entry
ABC0732           CDS       T00228                                 

Gene name
melA
Definition
(GenBank) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bcl  Bacillus clausii
Pathway
bcl00052  Galactose metabolism
bcl00561  Glycerolipid metabolism
bcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ABC0732 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    ABC0732 (melA)
   00600 Sphingolipid metabolism
    ABC0732 (melA)
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ABC0732 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: BAD63271
UniProt: Q5WK34
Position
complement(803662..804963)
Genome map
AA seq 433 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCMHVPALQQFEFALYDIDKERLSESQTLLTHLKNNLNST
ITIKAYDNRKEALRGASYVINAIQVGGYKPSTVIDFEIPKKYGLRQTIGDTIGIGGLFRS
LRTIPVLLDIAQDIEEVAPNAWFLNYTNPMAVLTGTLSRYTNVQNVGLCHSVQVCTRDLF
KHLEMDHTGIEEKIAGINHVAWLLEVKKDGQDLYPEIKRRAKEKNKEKHHDMVRFELMER
FGYYVTESSEHNAEYHPYFIKSTYPELIDDLNIPLDEYPRRCVSQIERWEQMKQDLVDNA
QITHERSIEYGSRIIEAMETGETFMFGGNVLNIGGLIANLPDKACVEVPCVANRSGITPT
YVGELPEQLAALNRTNINTQLLTIEAAITKKREHIYHAAMLDPHTSSELSLDDIVSLCDD
LIEAHGNYLPEYR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattacgtttatcggcgcaggcagcaccatttttgcgaaaaatgtactcggt
gattgcatgcacgtgccggcgctgcaacaatttgaatttgcgctttatgacattgacaag
gagcggctttcggaatcacagacattgcttacacacttaaaaaataatttaaactcaacg
atcacaataaaagcctatgacaaccgcaaagaagcgctacgcggcgcctcctatgtcatt
aacgccattcaagttggcggctataaaccaagcacagtcattgactttgaaatccctaaa
aagtatggcctgcgccaaacaatcggcgacaccatcggaattggcggcttgttccggtca
ttgcgtaccattccagttttgcttgatattgcccaagacattgaagaagtggcgccaaac
gcttggtttttaaactatacgaacccaatggctgtcttaactggcacgctttcacgctac
acaaacgtgcaaaatgttggcctttgccatagcgttcaagtgtgtacacgtgacttattt
aaacatcttgagatggaccatacagggattgaggaaaaaattgctggcattaaccatgtc
gcttggctccttgaagtgaaaaaagacggccaagacttatatcctgaaatcaaacggcgc
gccaaagagaaaaataaagaaaaacaccacgatatggtacgatttgagctaatggaacgg
tttggctactatgtaaccgagtcttccgagcacaatgctgaataccatccgtatttcatt
aaatcaacctatcccgagctgatcgacgacctcaatattcctttggatgaatacccacgg
cgctgcgtcagccaaattgaacgatgggagcaaatgaagcaagatcttgtcgacaatgct
caaattacccatgaacgttcgatcgaatatggatctcgaatcatcgaagcgatggagaca
ggtgaaacatttatgttcggtggaaatgttctcaatataggtggcttaatcgccaatctt
cctgataaagcgtgtgtagaagtaccatgcgttgccaatcgttctggcattacgcctacc
tatgttggcgagcttccagagcaactggctgctctaaacaggacgaacattaatacacag
ttattaacgattgaagcggcaataacaaaaaaacgggaacatatttaccatgctgctatg
ctcgacccccatacgtcttccgaactgtccctcgatgacattgttagcttatgtgacgat
ttaatcgaagcacatggcaattatttgcctgaataccgataa

DBGET integrated database retrieval system