KEGG   Bacillus clausii: ABC1731Help
Entry
ABC1731           CDS       T00228                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bcl  Bacillus clausii
Pathway
bcl00010  Glycolysis / Gluconeogenesis
bcl00052  Galactose metabolism
bcl00500  Starch and sucrose metabolism
bcl00520  Amino sugar and nucleotide sugar metabolism
bcl00521  Streptomycin biosynthesis
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
Module
bcl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC1731 (glcK)
   00052 Galactose metabolism
    ABC1731 (glcK)
   00500 Starch and sucrose metabolism
    ABC1731 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    ABC1731 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABC1731 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ABC1731 (glcK)
Enzymes [BR:bcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ABC1731 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: BAD64266
UniProt: Q5WH89
Position
1858467..1859447
Genome map
AA seq 326 aa AA seqDB search
MTEDYYAGIDIGGTTVKLAFLTETGELKDKWEIPTDVSENGKHIVDQIAASIQSRLPQHA
TLLGAGVGAPGFIEMKTGFIHHAVNIGWRNYPLREELERVLGVVVRVDNDANLAALGEKW
RGAGDGAEEELFITLGTGVGGGIITRGQILHGSSGMGGEIGHITVIPEGGAPCNCGKTGC
LETVSSATGILRMAKEKLTTNKDSALHRFEEGALTTKDIFDAAKAGDALAKDVVSEATFH
LGFAIANLANALNPSKIIIGGGVSKAKESLLAPLRLVFKQFALPRVSESAEIKLAHLGND
AGIYGAVWLAIQAKATQEEEMLGKSE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggactactatgcaggaattgacattggcggtacgaccgtaaagttggcgttt
cttacggaaacaggcgagttaaaagataaatgggagattcccacagacgtgagcgaaaac
ggcaaacatattgtcgatcaaatcgccgcaagcattcaaagccggctgccgcaacatgca
accttgttaggggctggagtaggtgcaccaggattcattgaaatgaaaactggttttatt
caccatgccgtcaatatcggctggcgaaactatccactaagggaagagcttgaacgcgtc
cttggagtggttgtccgcgtcgacaatgacgctaatttggcagcacttggagagaaatgg
cgcggcgcaggagatggcgctgaagaagagttgtttatcacacttggtacaggtgtcggc
ggtggcattattacaagagggcaaattctccacgggtcaagtggaatgggcggcgaaatt
ggccacataacagttatccctgaaggtggggcaccgtgcaattgcggcaaaacaggctgc
ctggaaacggtatcttcggcaacgggcattttacggatggccaaggaaaagttaacaaca
aataaggacagcgctttgcatcgctttgaagaaggggcgttaacgacaaaagatattttc
gatgctgctaaagctggcgatgcacttgctaaagatgtggtaagtgaagcaacctttcac
cttggttttgcaatagcgaacctggctaatgcgctcaatccaagcaaaatcattattggc
ggtggtgtttctaaagcgaaagaaagcttgcttgctccgcttcgcctcgtatttaagcaa
tttgcgttgccccgtgtttctgagagtgctgagattaaattggctcatttaggcaatgac
gctgggatttacggtgctgtttggcttgctattcaggcaaaagcaacacaggaagaagag
atgttaggaaaaagtgaatga

DBGET integrated database retrieval system