KEGG   Bacillus clausii: ABC1900Help
Entry
ABC1900           CDS       T00228                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcl  Bacillus clausii
Pathway
bcl00260  Glycine, serine and threonine metabolism
bcl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01130  Biosynthesis of antibiotics
bcl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC1900 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABC1900 (trpA)
Enzymes [BR:bcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABC1900 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA Syntaxin
Motif
Other DBs
NCBI-ProteinID: BAD64435
UniProt: Q5WGS0
Position
2016865..2017674
Genome map
AA seq 269 aa AA seqDB search
MNKRLRDAVKKGNLFIPFITAGDPVREATIALALSLQRSGADVLELGIPYSDPLADGPVI
QNASKRALAGGMTLAKAMALVPEMRKEGLTIPVIVFTYANPLLQFGFERFCETACDYGID
GLLVPDLPFEESETLANECEKQGLALISLVAPTSQQRIKAIASRAQGFLYCVSSLGVTGA
RKTLHPQVEAFLKLVKEASPVPFVVGFGISSYEQVEEMGRHADGVVIGSAIVEQIGLRCE
ALKQAESRDEAVKEIEQYVNSLLHPAPTY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcggcttcgtgatgctgtaaaaaagggcaacttgtttattccgttcattacc
gccggagacccggtgcgagaagcaaccatcgccctcgcactctcattacagagaagtggg
gcggatgtgctggagcttggcattccttattctgacccgttggcagatggaccggtcata
caaaacgcctccaaacgtgcactagcaggaggaatgacactggctaaggcgatggcgctc
gtcccggaaatgagaaaagaggggcttacaattcctgttattgtctttacttacgccaac
cctttgctacaatttgggtttgaacgtttttgtgagaccgcatgcgactacggaattgac
ggcctcctcgttcccgatttgccgtttgaagagagcgaaacattggctaatgagtgtgaa
aaacaagggcttgcccttatatcacttgtggcgccaacatctcagcaacggatcaaagcg
attgccagccgcgcccaagggttcctatactgtgtgtcctcgctaggcgtaactggcgcg
agaaaaacacttcatccacaagtagaagcttttttaaagctggtaaaagaagcatcgcct
gtcccgtttgtagttggatttggcatttccagctacgaacaagttgaggaaatggggcgc
catgctgacggtgttgtgatcgggagtgcgattgttgagcaaattggcctcagatgcgag
gcgttaaaacaggcggaatcacgagatgaagcagtcaaagaaattgagcaatatgtcaat
tctcttcttcatcccgctccgacctattaa

DBGET integrated database retrieval system