KEGG   Bacillus clausii: ABC2322Help
Entry
ABC2322           CDS       T00228                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bcl  Bacillus clausii
Pathway
bcl00230  Purine metabolism
bcl01100  Metabolic pathways
Module
bcl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABC2322 (gmk)
Enzymes [BR:bcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ABC2322 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_30 ABC_tran AAA_16 YtxH AAA_22 RsgA_GTPase AAA MMR_HSR1 AAA_33
Motif
Other DBs
NCBI-ProteinID: BAD64857
UniProt: Q5WFK3
Position
complement(2446781..2447398)
Genome map
AA seq 205 aa AA seqDB search
MKREKGLLIVLSGPAGVGKGTVCGALRNQNTAIEYSVSATTRKPREGEKHGVNYFFKTRE
QFEQMIEDGKLLEWAEYVGNYYGTPIDYVQETINAGKDIILEIEVQGAQKVRTVFPEGVF
IFLAPPSLKELRDRIVGRGTETEDIINERMTVAKEEIDLMTMYDYVVENDKVEWAVERIK
AIVTAEHCKRERLIKKYKELVEVEK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagaaaaagggctgcttatcgtattatcagggccagcaggcgtcggcaaaggc
acggtttgcggggcattgcggaaccagaatacagcgattgagtattctgtttcggcgacg
acgcggaaaccacgcgaaggcgaaaagcatggtgtcaactatttttttaaaacgcgagaa
caatttgagcaaatgatcgaggatggaaaattactagaatgggccgagtatgtcggcaat
tattatggcacgcccattgactatgtccaggagacgatcaatgctgggaaagacattatt
ttagaaattgaagtgcaaggagcgcaaaaagtccgaaccgtatttccagaaggggtattt
atttttttagcgcctccaagcttaaaagaattgcgtgaccggattgtcggacgtggcacg
gaaacagaagacattattaatgaacggatgaccgtagcaaaagaagaaattgatttaatg
accatgtatgattacgtcgtcgaaaacgataaagtcgaatgggccgttgagcggattaaa
gcgattgtaacagctgaacattgcaaacgggaacgcctaataaaaaaatacaaagaactt
gtggaggtcgaaaaataa

DBGET integrated database retrieval system