KEGG   Bacillus clausii: ABC3617Help
Entry
ABC3617           CDS       T00228                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcl  Bacillus clausii
Pathway
bcl00071  Fatty acid degradation
bcl00072  Synthesis and degradation of ketone bodies
bcl00280  Valine, leucine and isoleucine degradation
bcl00310  Lysine degradation
bcl00362  Benzoate degradation
bcl00380  Tryptophan metabolism
bcl00620  Pyruvate metabolism
bcl00630  Glyoxylate and dicarboxylate metabolism
bcl00640  Propanoate metabolism
bcl00650  Butanoate metabolism
bcl00900  Terpenoid backbone biosynthesis
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
bcl01212  Fatty acid metabolism
bcl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABC3617
   00630 Glyoxylate and dicarboxylate metabolism
    ABC3617
   00640 Propanoate metabolism
    ABC3617
   00650 Butanoate metabolism
    ABC3617
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABC3617
   00072 Synthesis and degradation of ketone bodies
    ABC3617
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABC3617
   00310 Lysine degradation
    ABC3617
   00380 Tryptophan metabolism
    ABC3617
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABC3617
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABC3617
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABC3617
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcl04147]
    ABC3617
Enzymes [BR:bcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABC3617
Exosome [BR:bcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABC3617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: BAD66150
UniProt: Q5WBW0
Position
complement(3770665..3771801)
Genome map
AA seq 378 aa AA seqDB search
MAHVSVTGTGRTAFGRRSESIKALLVEASRQALTAAGRPKIDAVFVGNFLGGALSQQEIL
GAILANELGLGPIPAMKVEGACASGGIAFRQAYQLIKAGEYNAVLVAGVEKMTNVDTETV
TNAINAAMDAESNESATGLTFPGYFGAVANRYIHEYGAQRKHLAMVALKNRMYAQANPIA
QFQKAISLEDVLTARPVTDPLRLLDCSPISDGAAAVVLQKSESGVRVLSSGQASGTPLMQ
EVGNLLRIEATHRAAQQAYAQAGLGPEDVDAVELHDCFSITELIAIEELGFADRGKGWEA
VEQGLTQHGGNVPVNTSGGLLSKGHPIGATGIAQIVQIAEQLNGIACNQVDGARIGLAQN
LGGTGAYSVVHLFAKEGS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgtgtccgtaaccggtactggacgaacggcgtttggaagaaggagcgaatcg
attaaagcgcttttggtagaagccagccgccaggcattgaccgctgctggccggccgaaa
atcgatgctgtgttcgtcggcaactttttaggcggagccctttcacagcaagaaattctc
ggtgcgatccttgccaatgagttaggcttagggcctattccagccatgaaagtcgaaggc
gcttgtgcttcgggaggcattgcttttaggcaagcgtaccaactcatcaaagctggcgaa
tacaacgccgttctggtcgcaggggtggaaaaaatgacaaacgttgatacagagaccgtc
accaatgcgattaacgcagcgatggacgccgaatcgaacgaaagcgcgacggggctaacg
tttccaggttattttggcgctgtggccaaccgctacatccacgaatatggcgcacaacga
aaacacttggcgatggtcgccttaaaaaaccggatgtacgcccaagccaatcctatcgcc
caatttcaaaaggctatttcgttagaagatgtgttaacggcaaggcccgttaccgacccg
ttgcggttgctcgactgttcaccgatttccgacggagcggcagcagtcgtcctgcaaaaa
agcgaatcaggcgtccgtgtgttgtcatcaggccaagcgagcggcacgccgctcatgcaa
gaagtcggtaacttgcttaggatcgaagcgacacatcgtgccgcccagcaagcttatgca
caagccggactcggtcctgaagacgtcgacgcagtcgagcttcatgactgtttttccatt
actgaactgattgcgattgaggagcttggctttgcggatagaggcaaaggctgggaagca
gtggagcaaggcctgactcagcatggcggcaatgttcctgtgaatacaagcggagggctg
ttatcaaaaggccaccctattggcgccacaggcatcgcccaaatcgtgcaaattgcagaa
cagctaaatggcatcgcctgcaaccaagtagatggcgcgcgcattggccttgcccaaaac
ctaggcggcactggcgcgtattcggttgtccacttattcgctaaggaagggagctaa

DBGET integrated database retrieval system