KEGG   Bacillus clausii: ABC3740
Entry
ABC3740           CDS       T00228                                 

Gene name
pucA
Definition
(GenBank) xanthine dehydrogenase subunit E
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bcl  Bacillus clausii
Pathway
bcl00230  Purine metabolism
bcl01100  Metabolic pathways
bcl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ABC3740 (pucA)
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ABC3740 (pucA)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 DUF348
Other DBs
NCBI-ProteinID: BAD66272
UniProt: Q5WBI8
Position
complement(3898994..3899521)
AA seq 175 aa
MAFTRANNRKVSLTFQINGQTRQVETYASVRLADVLREELGLTGTKVSCGIGRCGACAVL
MDGKVVNSCLLMAFQATNVELQTIEGITASAENGVDPVQQAFLEEGGFQCGYCTPGMVVA
AKALLNENQAPSDEEMAEALSGNLCRCTGYAGIIRAVRKAAKGKQSDVEGPNSSA
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcattcacacgtgctaacaaccgaaaagtaagcctgacctttcaaatcaatggccag
acgaggcaagtggaaacatacgctagcgtgaggctggctgatgtgttgagagaggaacta
ggcttgactggcacaaaagtgtcatgcggcattggccgttgcggtgcctgcgccgtgcta
atggatggaaaagtggtcaatagctgtttgctcatggcgttccaagcaacgaatgtcgag
ttgcaaacgattgaaggaattaccgcttctgccgaaaacggggttgaccctgtgcagcaa
gcatttttagaagaaggtggcttccaatgcggctattgcaccccagggatggtggtcgct
gccaaagcgttgctgaatgaaaaccaggccccgagtgatgaggaaatggccgaagcattg
tcaggcaatttatgccgttgtactggctacgccggcattatccgagccgtgcggaaagcg
gcaaagggaaagcagagtgatgtcgaagggccgaacagtagcgcgtaa

DBGET integrated database retrieval system