KEGG   Bacillus clausii: ABC3744
Entry
ABC3744           CDS       T00228                                 

Gene name
pucE
Definition
(GenBank) xanthine dehydrogenase subunit A
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bcl  Bacillus clausii
Pathway
bcl00230  Purine metabolism
bcl01100  Metabolic pathways
bcl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ABC3744 (pucE)
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ABC3744 (pucE)
SSDB
Motif
Pfam: XdhC_C XdhC_CoxI
Other DBs
NCBI-ProteinID: BAD66276
UniProt: Q5WBI4
Position
complement(3903183..3904187)
AA seq 334 aa
MENMHDIISRLDKTNQRTMLATIIAVDGSAYRKEGTTMLVEEDGTRTGLLSAGCLEEDIS
ARFASVWAQGPMVERYNMRSLDDSSWGLDGSGCNGVVDVLLQPVNDTLLSFLRKTGQALA
RGQTVALIRSEDVSQYLCQTESGEMFGVWNGENPQLAGVEKSGVIYSTSLTKNLYLQVIR
PKPRLFVFGAQADAKPLVQFAAKVGFSVHVVDWRPALCTKTHFPNADKRIIGFPHEVIPT
LSFKKDDAVLLMTHHFQRDQEIVSHLLDVHLAYFGILGSKARTARLLAAAHVPEGIRTPV
GLPIRAEGPEEIAVSVVAELIQMVKAEQRTQALT
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggaaaatatgcatgacatcatcagtcggctcgacaagacgaaccaacgaacaatgctg
gcaacgattatcgctgttgatggctctgcttaccgcaaagaagggacaacgatgctagtg
gaagaagacggcactagaaccggccttttaagcgctggctgcttagaggaggacattagc
gcccgctttgcttctgtttgggcgcaagggcctatggttgagcgctataatatgcgctcc
cttgacgattcttcctggggactagacggcagtggctgcaatggtgttgttgatgtgcta
ttgcagccggtgaacgatacgttgctttcattcctgcgtaaaacagggcaggctctagcg
agagggcaaacggtagcgcttatccgcagcgaggatgtaagccaatatctttgccagaca
gagtctggggaaatgtttggcgtttggaatggggagaacccacagttggcaggggttgaa
aaaagcggcgttatttacagcactagcttaacgaaaaacctatacctccaagtgatacgg
ccaaagccaaggctgtttgtgtttggcgcccaggctgacgccaaaccgctcgtgcagttt
gctgccaaagtcggcttcagcgtccatgtggtcgattggcgccccgctctctgtacaaaa
actcattttcctaatgctgataaacgtatcatcggttttcctcatgaagtcattccaacg
ctttcttttaaaaaagacgatgccgtcctgcttatgacccaccactttcaacgggatcaa
gaaattgtatcccacttgcttgatgtccatcttgcctatttcggcatccttggttcaaaa
gcacgtacggctcgtttgctagcagccgctcacgtgccagagggaatccgcacaccggtc
ggcttgccaatccgagcggaagggcccgaagaaattgcggttagcgttgtcgccgaattg
atccaaatggtaaaagcagaacaacggacacaggcgctaacatga

DBGET integrated database retrieval system