KEGG   Bacillus clausii: ABC3891Help
Entry
ABC3891           CDS       T00228                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcl  Bacillus clausii
Pathway
bcl00071  Fatty acid degradation
bcl00072  Synthesis and degradation of ketone bodies
bcl00280  Valine, leucine and isoleucine degradation
bcl00310  Lysine degradation
bcl00362  Benzoate degradation
bcl00380  Tryptophan metabolism
bcl00620  Pyruvate metabolism
bcl00630  Glyoxylate and dicarboxylate metabolism
bcl00640  Propanoate metabolism
bcl00650  Butanoate metabolism
bcl00900  Terpenoid backbone biosynthesis
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
bcl01212  Fatty acid metabolism
bcl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABC3891 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    ABC3891 (mmgA)
   00640 Propanoate metabolism
    ABC3891 (mmgA)
   00650 Butanoate metabolism
    ABC3891 (mmgA)
  Lipid metabolism
   00071 Fatty acid degradation
    ABC3891 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    ABC3891 (mmgA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABC3891 (mmgA)
   00310 Lysine degradation
    ABC3891 (mmgA)
   00380 Tryptophan metabolism
    ABC3891 (mmgA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABC3891 (mmgA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABC3891 (mmgA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABC3891 (mmgA)
Enzymes [BR:bcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABC3891 (mmgA)
Exosome [BR:bcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABC3891 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAD66422
UniProt: Q5WB38
Position
complement(4046853..4048037)
Genome map
AA seq 394 aa AA seqDB search
MKTAIVSGARTPIGKMGGVLSPLKAAELGGIVLEEALKRAQVNAERVDEVIMGQVLQAGA
GQLPSRQAAHAAGIPWRAKTETINKVCASGMRAVTLGDLSIRAGEASTVLAGGMESMSNA
PYYMKKARFGARMGDTTLLDGMIYDGLTCSFNDVHMGVYGNRTANELSISREEQDRWAAR
SQERAVAAIESGIINEEIVSVSVKGRKGETVLVRQDEAPRKGTTVDSLAQLKPVFGKEGT
ITAGNAPGVNDGACALLLMEAAQAEKQGKPILATIEAHHRLAVEPWDFPKTPGLVISELL
EKTKLTVADIRRFEINEAFAAVALASNQIAGLDEEKVNVNGGAVAYGHPIGASGARILLT
LAYELKRSGGGYGIAAICSGGGQGDAVLLHVKGE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagctattgttagtggagcgaggacgccaattggaaaaatgggaggcgtgctt
tcaccattaaaagccgctgaacttggtggcattgtgttagaagaggcattgaaacgggcg
caagtgaatgcagaaagagtcgatgaagtcattatggggcaagtgttgcaagcaggggct
ggccagcttccatcgaggcaagcagcacatgcggccggcattccatggcgtgcaaaaacc
gaaacgatcaacaaagtatgtgcttcgggcatgagggcggtaacccttggcgacttgtct
attcgcgcaggcgaagcgagcacagttctcgctggtggaatggagtcgatgtcgaatgct
ccttattatatgaagaaagcacgatttggggcacgaatgggcgatacgacgttgcttgat
ggaatgatttatgatgggctgacctgttcgtttaacgatgtgcatatgggcgtgtatggg
aataggacggcaaacgaactaagcattagccgcgaggaacaggatcgctgggctgctagg
agtcaagaacgtgctgttgcagcaattgaaagcggtatcattaatgaagagattgtttcc
gtttcggtaaaaggcagaaaaggggaaaccgttcttgttcgtcaagacgaggcgccgcgc
aaaggaacgaccgttgatagccttgctcaacttaagcctgtttttgggaaagagggaacg
attacggcaggcaatgccccaggcgtcaatgacggtgcctgtgcattgctattaatggaa
gctgcacaagcagagaaacaaggcaagccaattttggcaacgattgaagcccatcaccgc
cttgccgtcgaaccatgggactttccgaaaacaccaggccttgttataagcgaattattg
gagaaaacaaagttaactgttgcggatataaggcggttcgaaatcaatgaggcgtttgca
gcagtggctttagcaagcaaccaaatagctggattagatgaagagaaagtcaatgtcaac
ggaggcgcggttgcttatgggcacccaattggcgcaagtggcgctcgaattttgctaacg
cttgcttatgaattgaagcgcagcgggggcggttatgggatagctgcgatttgcagcggc
ggtggccaaggcgatgccgtattgctacatgtgaaaggggaatga

DBGET integrated database retrieval system