KEGG   Bacillus clausii: ABC3952Help
Entry
ABC3952           CDS       T00228                                 

Gene name
phoB
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bcl  Bacillus clausii
Pathway
bcl00730  Thiamine metabolism
bcl00790  Folate biosynthesis
bcl01100  Metabolic pathways
bcl02020  Two-component system
Module
bcl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ABC3952 (phoB)
   00790 Folate biosynthesis
    ABC3952 (phoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABC3952 (phoB)
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ABC3952 (phoB)
Exosome [BR:bcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABC3952 (phoB)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bcl00537]
 Enzymes
  ABC3952 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme PHY
Motif
Other DBs
NCBI-ProteinID: BAD66483
UniProt: Q5WAX7
Position
complement(4109349..4110689)
Genome map
AA seq 446 aa AA seqDB search
MKRSKKLAVAGLVGIVCLGATYTAAFASDSGEVGEEGNQPSSGQAKNVIFLIPDGFSQGY
TNNYRLYKEDGEPIWDERNMLRAFVQTHSANAEVTDSAAAGTALATGEKTNNGMIGVTPA
GQTLPTILDSAKENGKRTGLVATSTITHATPAAFAVSVESRNSYTEIASQMVANDHIDLM
LGGGRTEFVPEDQGGIREDGVDLISEAEEKGFAFVETARQLANWNGEEDRLLGLFAEEAL
SPAANKRTDEPSLGEMTEKAIEFLSKEDNGFFLMVEGSQIDWAGHANDAYYAMTDTAAFE
EAVEAAVDFADENGETLVVMVGDHDTGGMAVHASEEGDPSKLHGVSALGSDMAAEVERNY
SNLKEVLETYTNFEWTEEELDQLKESDSLELAINTAISEKAGVAWSSLDHTGIDVPLYAY
GAGAERFTGTIDNTEVPKIMKAALGI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttcaaagaaattggcagtggcagggctggttgggatcgtgtgtcttggagcg
acctacacggcggcatttgcatcagacagtggggaagtaggagaagaaggcaatcagcct
agcagtggacaagccaaaaatgtcatctttttaattcctgatggcttttcgcaaggctat
acaaacaattaccgtttatacaaggaagatggcgagcctatttgggacgaacgcaacatg
ctgcgcgccttcgtgcaaacgcactcggcaaatgcagaagtgaccgattccgctgcagca
ggcacagctttagcaaccggggaaaaaacgaataatggcatgatcggcgtaactcctgct
ggacaaacattgccgacaattctcgactcagcgaaagaaaacggcaagcgcacaggactt
gtggctacatcaacgattacacacgcgacgcctgccgcttttgctgttagcgtagagtca
cggaacagttatacagaaatcgcctcacaaatggtcgcaaacgatcatatcgatttaatg
cttggtggtggccggacagagtttgtgcctgaagaccaaggcggtattcgcgaagatggc
gtcgatttaataagcgaagcagaagaaaaagggtttgcatttgtagagacagcgcggcaa
ttagcgaactggaatggtgaagaagaccgcttgcttggcttgtttgctgaagaagcactg
tcgccggcagctaataaacggacggacgagcctagtttaggggagatgactgaaaaagca
attgaattcttgtcaaaagaggacaatgggtttttcttaatggtagaaggcagccaaatt
gactgggctggacacgccaatgacgcctattacgccatgacagatacggccgcttttgaa
gaagcagtcgaagcagcggtcgattttgccgatgagaatggcgagacgcttgtcgtcatg
gtcggcgatcatgatacaggggggatggccgttcacgcatcagaagaaggggatccgtct
aagcttcatggtgtctctgctctagggagcgacatggctgcagaagtcgaacggaattat
agcaacttaaaagaagtgcttgaaacgtacaccaattttgaatggacagaagaagaattg
gatcaactgaaagaaagcgactcactggaattagcgatcaatacggccatcagcgaaaaa
gcaggcgtagcctggtcatcgttagatcatacaggcattgacgtgccactgtacgcttac
ggcgccggggcagaacggtttaccggcacgatcgacaacactgaagtcccgaaaatcatg
aaagcagcgctggggatttaa

DBGET integrated database retrieval system