KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0844Help
Entry
Bcenmc03_0844     CDS       T00669                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00521  Streptomycin biosynthesis
bcm00523  Polyketide sugar unit biosynthesis
bcm01130  Biosynthesis of antibiotics
Module
bcm_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Bcenmc03_0844
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcenmc03_0844
Enzymes [BR:bcm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Bcenmc03_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACA90022
UniProt: B1JX03
Position
1:936996..937547
Genome map
AA seq 183 aa AA seqDB search
MAIQVTATALPEVKIIEPKVFGDARGFFYESFNGKEFAEQVAPGVEFVQDNHSRSSKGVL
RGLHYQIQHAQGKLVRVVEGEVFDVAVDIRKDSPNFGKWVGVVLSNDNHRQLWVPPGFAH
GFVVLSEAAQFLYKTTDYWFPEHERSIVWNDPEIGIEWPIDFEPLLAAKDAAGKRLSEAE
VYA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggccatccaagtaacggcaacggcgctgcccgaagttaagatcatcgagccgaaggtg
ttcggcgacgcgcgcgggttcttctacgaaagcttcaacgggaaggaattcgccgagcag
gttgcacccggcgtcgaattcgtgcaggacaaccattcgcgctcgtcgaagggcgtgctg
cgcggcctgcactatcagatccagcacgcgcagggcaagctcgttcgcgtggtcgagggc
gaagtgttcgacgtcgccgtcgacattcgcaaggattcgcccaacttcggcaagtgggtg
ggtgtggtgctgtcgaacgacaaccatcggcaactgtgggtgccgcccggtttcgcgcac
gggttcgtcgtgctgtcggaggccgcacagttcctctacaagacgaccgactactggttt
ccggaacacgagcgtagcatcgtgtggaatgatccggagatcgggatcgagtggccgatc
gatttcgaaccgctgctggcggcgaaggatgcggccggcaagcgtttgagcgaagccgaa
gtttatgcgtga

DBGET integrated database retrieval system