KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0997Help
Entry
Bcenmc03_0997     CDS       T00669                                 

Definition
(GenBank) ubiquinone biosynthesis O-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00130  Ubiquinone and other terpenoid-quinone biosynthesis
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Bcenmc03_0997
Enzymes [BR:bcm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     Bcenmc03_0997
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     Bcenmc03_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_31 CMAS PrmA MTS NodS Ubie_methyltran Methyltransf_9 TPMT MetW TehB
Motif
Other DBs
NCBI-ProteinID: ACA90174
UniProt: B1JXR2
Position
1:complement(1103121..1103819)
Genome map
AA seq 232 aa AA seqDB search
MTNADPHELQKFSDLAHRWWDPNAEFKPLHDLNPVRLGWIDAHAHLAGKRALDIGCGGGI
LSESMAGLGAQVKGIDLSTEALGVADLHSLESGISVEYEAIAAEAIAAREPGTYDVVTCM
EMLEHVPSPGDIVAACATLVKPGGWVFFSTLNRNLKSYLFAVIGAEYIAQMLPKGTHDYA
RFIRPSELASFVRATDLHIVEIKGITYHPIGKRFALSNDTDINYLVACRRGA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgccgatccgcacgaactccagaaattcagcgacctcgcccaccgatggtgg
gatccgaatgccgaattcaaaccgctgcacgacctgaacccggtccggctcggctggatc
gacgcgcatgcgcacctggccggcaagcgcgcactcgacatcggctgcggcggcggcatc
ctgtccgaatcgatggccgggctcggcgcccaggtgaaaggcatcgacctgtcgaccgaa
gcgctcggcgtggccgatctgcacagcctcgaaagcggcatttcggtcgagtacgaggcg
atcgccgccgaagcgatcgccgcgcgcgaaccgggcacctacgacgtcgtcacgtgcatg
gaaatgctcgagcacgtaccgtcgcccggcgacatcgtggccgcgtgcgcgacgctcgtg
aaaccgggcggctgggtgttcttctcgacgctgaatcgcaacctgaagtcctacctgttc
gccgtgatcggcgcggaatacatcgcgcaaatgctgccgaagggcacgcacgattacgcg
cgtttcatccgcccgtcggaactggccagcttcgtgcgcgcgacggatctgcacatcgtc
gagatcaagggcatcacgtaccacccgatcggcaagcgcttcgcgctgtcgaacgacacc
gatatcaactacctggttgcgtgccgtcgcggcgcgtga

DBGET integrated database retrieval system