KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2054Help
Entry
Bcenmc03_2054     CDS       T00669                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00480  Glutathione metabolism
bcm00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bcenmc03_2054
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcenmc03_2054
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bcenmc03_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ACA91215
UniProt: B1JUG5
Position
1:complement(2283945..2284424)
Genome map
AA seq 159 aa AA seqDB search
MSTLYSFSAETLAGAPVSLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDQYAARGFFVL
GFPCNQFGKQEPGDAAQIGAFCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDEAPGILGL
KAIKWNFTKFLIDREGRIVKRYAPSTKPDEIAADIDKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccctgtattcgttcagcgcagagacgctcgccggtgcgccggtatcgctcgac
gcgtatcgcggcaaggtgctgctgatcgtcaataccgcgagcgagtgcggtttcacgccg
cagtacgcgggtctgcagaagctgtacgaccagtacgcggcgcgcggcttcttcgtgctc
ggcttcccgtgcaaccagttcggcaagcaggagccgggcgatgccgcgcagatcggggca
ttctgcgagcgcaactacggcgtcacgtttccgatgttcgcgaagatcgacgtgaagggc
gaccatgcgcatccgctgtatcgctacctgaccgacgaggcgcccggcattctcggcctc
aaggcgatcaagtggaatttcacgaaattcctgatcgaccgcgaagggcgcatcgtcaag
cgctacgcgccgtccaccaagcctgatgaaatcgcagcggacatcgacaagctgctgtga

DBGET integrated database retrieval system