KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2495Help
Entry
Bcenmc03_2495     CDS       T00669                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Sacchrp_dh_NADP NAD_binding_10 Epimerase RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ACA91656
UniProt: B1JWX6
Position
1:complement(2789097..2789852)
Genome map
AA seq 251 aa AA seqDB search
MKTSGNTILITGSTSGIGLGLAMRFHKAGNKVIVAGRRKALLEQITTDHPGIEAIELDVA
DAESIVQASELAAARYPDLNVVINNAGIMLSENVLEPESLKAAEESVAINLLGTIRMTYA
FLPQLSRKDDGVIINVSSALAFVPFPIAMTYSATKAAVHAFTEGLRVQLADTSVRVIELA
PPGVRTTLFGQEGDEHAMPLEDFLDETLALLHAEPTPKEIIVERARFLRTAQATGNYDKA
LGMLSAWKAPD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttcgggcaacacgatcctcatcaccggctcgacctcaggcatagggctcggt
ctggcgatgcgctttcataaggcgggcaacaaggttatcgtcgcaggccgacgtaaggcg
ctgcttgagcagatcaccaccgatcatccaggtatcgaggccatcgaactcgacgtggcc
gacgccgagtcaatcgtccaggcgagcgagctggcagccgcgcgttaccccgacttgaat
gttgtcatcaacaacgccggcatcatgttgagcgaaaatgttctggagccggagtcgctg
aaggctgcggaagagtcggtcgcgatcaaccttctgggcaccattcgcatgacctatgcg
ttcttgccacagctttcgcggaaagacgatggcgtcatcattaatgtcagttcggcattg
gcgtttgttccgttccctattgccatgacctacagcgccaccaaggcggccgttcacgcg
ttcaccgaaggcttgcgcgttcaactcgccgacacatccgtgcgcgtgatcgagttggcg
ccccctggcgtgcgcaccacgttgttcggtcaggaaggcgacgaacacgccatgcccctc
gaagacttccttgacgagacgctcgctcttttgcatgcagagcccacaccaaaggaaatc
atcgtggaacgcgccagatttctccgtactgcccaggctaccggcaactacgacaaggcc
cttggaatgctctccgcatggaaggccccagactga

DBGET integrated database retrieval system