KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2678Help
Entry
Bcenmc03_2678     CDS       T00669                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00020  Citrate cycle (TCA cycle)
bcm00640  Propanoate metabolism
bcm00660  C5-Branched dibasic acid metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
Module
bcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcenmc03_2678
   00640 Propanoate metabolism
    Bcenmc03_2678
   00660 C5-Branched dibasic acid metabolism
    Bcenmc03_2678
Enzymes [BR:bcm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcenmc03_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp K-cyclin_vir_C Dockerin_1
Motif
Other DBs
NCBI-ProteinID: ACA91838
UniProt: B1JY14
Position
1:complement(2984447..2985613)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcggaagagctgggcggc
ccggtatgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggtccgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggtccggaaggccagaaggtcaaccgtctgatgatcgaggaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgaccgcatctcgcagaag
atcgtgctgatgggttcgagcgaaggcggcatggacatcgaagaagtcgccgaaaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctcgacgcgcaggcc
gacgacctcgccgcgaagatcggcgtgccggccgcgtcgattccgcaagcgcgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctggccgaaatcaacccg
ctgaacgtctccggcgacggcaaggtcaccgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgccacccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcaggcctcgcgatggcgacgatggacaccatcaagctgttcggc
ggcgaaccggcgaacttcctggacgtcggcggcggtgcgacgaccgagaaggtcacggaa
gcgttcaagctgatgctgaagaacccggacctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctcggcaagaagatg
ctggccgattcgggcctgccgatcatctcggccgacagcatggaagaggctgcgcagaag
gtcgtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system