KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3570Help
Entry
Bcenmc03_3570     CDS       T00669                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00260  Glycine, serine and threonine metabolism
bcm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01130  Biosynthesis of antibiotics
bcm01230  Biosynthesis of amino acids
Module
bcm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcenmc03_3570
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcenmc03_3570
Enzymes [BR:bcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcenmc03_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACA92722
UniProt: B1K368
Position
2:complement(453444..454637)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFQNDPDFVAEFERELKYFVGRPSP
IYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDAEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKLLLVNLSGRGDKDMHTVAERSGIEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgatgatcgcggccatttcggcccgtatggcggcgtgttcgtcgcc
gagacgctgattcacgcgctggacgaactgcgcgcggcgtatgaaaagttccagaacgat
cccgacttcgtcgccgaattcgagcgcgagctgaagtatttcgtcggccgcccgtcgccg
atctatcacgcgcagcgctggagcgagatgctcggcggcgcgcagatctacctgaagcgc
gaagacctgaaccacacgggtgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaagcgcgtgatcgcggaaacgggcgccggccagcacggcgtc
gcgaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggctcggag
gacgtgcgccggcaggccgcgaacgtctaccggatgaagctgctgggcgcgaccgtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcacgaatatcgaaagcacgttctacatcatcggcacggtcgcgggcccgcacccgtac
ccgatgatggtgcgcgacttccagcgcgtgatcggtgacgagtgcaaggtgcagatgccc
gagctcgccggccgccagccggacgcggtgatcgcgtgcgtcggcggcgggtcgaacgcg
atgggcatcttctatccgtacatcgacgatacctcggtgcaactgatcggcgtcgaagcg
gccggcgacggcctcgacacgggccatcacgctgcctcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacgtacctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggcgggcctcgattatccgggcgtcggtcccgagcacgcatggctgaag
gacagcggccgcgcgcagtacgtgccgatcaccgacgcggaagcgttgaaggcgtttcac
gactgctgccggatcgaggggatcattcccgcgctcgagtcgagccacgcgatcgcgtac
ggcgtgaagctcgcgccgacgttgccgaaggacaagctcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgagctctga

DBGET integrated database retrieval system