KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4093Help
Entry
Bcenmc03_4093     CDS       T00669                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00010  Glycolysis / Gluconeogenesis
bcm00071  Fatty acid degradation
bcm00350  Tyrosine metabolism
bcm00625  Chloroalkane and chloroalkene degradation
bcm00626  Naphthalene degradation
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_4093
  Lipid metabolism
   00071 Fatty acid degradation
    Bcenmc03_4093
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcenmc03_4093
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcenmc03_4093
   00626 Naphthalene degradation
    Bcenmc03_4093
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcenmc03_4093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N PALP ADH_zinc_N_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACA93244
UniProt: B1K725
Position
2:1033515..1034594
Genome map
AA seq 359 aa AA seqDB search
MKAAILKSLGQPLAIETLPDPVLGTGEVVVDVVATPVLSYAREVFSGERRYPIKLPMVPG
CGAIGRVRQTGPDATQLQPGDWVFCDPTVRSRDDARMPDIVLQGWSARGEGGKQLQRYFR
DGPFAERLRVPTENAVRIGAIAPADAARWCALNTLLVPYGGLLASDLRAGEILLVSGATG
NFGSACIAVALAMGAQCVVAPGRNARVLAELERRFGERVRTVGLTGDETADRIRMQQAAP
GPIDCVIDLMPPSVPATTVRAAVMAVRPYGRVVLMGGVGMLGGAGLELPYPWIMRNDITL
RGKWMYPTEAVTLMTGLVRGGLLDLGHFDVTVFALDDANDAVVHAAEHGGPFRMTVIVP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgatcctgaagtcgctcggccagccgctcgcgatcgaaacgctgccggac
cccgtgctcggcaccggcgaagtcgtcgtggacgtcgtcgcgacaccggttctgtcctat
gcgcgggaagtgttcagcggcgagcgccgctatccgatcaagttgccgatggtgccgggc
tgcggcgcgatcggccgggtccggcaaaccggccccgacgcgacgcaattgcagccgggc
gactgggtgttctgcgacccgaccgtgcgctcgcgcgacgatgcgcggatgcccgacatc
gtgctgcagggctggagtgcgcgcggcgaaggcggcaagcagttgcagcgctattttcgc
gacggcccgttcgccgagcggctgcgcgtgccgaccgagaacgcggtgcgcatcggcgcg
atcgcgccggccgacgccgcgcgctggtgcgcgctcaatacgctgctcgtgccttacggc
ggcctgcttgcgtccgacctgcgcgccggcgaaatcctgctcgtcagcggcgcgaccggc
aatttcggcagcgcctgcatcgcggtggcgctggcgatgggcgcgcaatgcgtggtcgcg
cccggccgcaatgcacgcgtgctggcggagctcgaacgccgcttcggcgagcgcgtgcgc
acggtcgggctgaccggcgacgaaaccgcggaccgcatccgcatgcagcaggcggcgccg
gggccgatcgactgcgtgatcgacctgatgccgccgtcggtgccggcgacgacggtgcgt
gccgccgtgatggccgtgcgtccttatggacgcgtggtgctgatgggcggcgtcggcatg
ctcggcggagccgggctcgagctgccgtatccgtggatcatgcgcaacgacatcacgctg
cgcggcaaatggatgtatccgacggaagccgtgacgctgatgaccgggctcgtccgcggc
gggctgctcgacctcgggcatttcgacgtgacggtcttcgcgctcgacgacgcgaacgac
gcggtcgtgcatgcggcggaacatggcgggccgttcaggatgacggtgatcgtgccgtag

DBGET integrated database retrieval system