KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4195
Entry
Bcenmc03_4195     CDS       T00669                                 

Definition
(GenBank) conjugation TrbI family protein
  KO
K03195  type IV secretion system protein VirB10
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcenmc03_4195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcm02044]
    Bcenmc03_4195
Secretion system [BR:bcm02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bcenmc03_4195
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ACA93346
UniProt: B1K7J3
Position
2:complement(1130454..1131677)
AA seq 407 aa
MTEDTSPNGAATDDEIRRNSPADMNTGMGSESSVMLDRGMPSLDGFGRRSFINWLVPLTI
IVLALIGAVWTVHGVLAHRDEAARARRSALHARGAHEKVFDEVPALAESASAAAMPTPTP
APAAVQPVPSSDRAAPLRSYYDAPLLAVGASNGQMADASESESASPSILPAHADQQQSNA
TAGMAEERAKPFSQPLSQALTPTRVPTVIAAFIGNRSLLLAQGTKIDCAGDTAFDSTQAG
ISTCTVARNVYSDDGRVVLIERGSQINCEYRANLSPGQRRVFVLSARIATPHGVTVQIDS
PVADALGRMGMDGSIENHWGARVGAAMMLGLSHDAIGYLATRGGNGNGTIVYQNTQAQGN
DMATRVLDQTINIAPTLRQHQGTEFTIVLARDLDFSSVYTLEPEGVR
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgactgaggacacttcgcccaacggcgcagcgacggacgacgagattcgtcgcaacagc
ccggcagatatgaacacgggtatggggtccgaatcgtctgtcatgctcgatcgcggcatg
cccagcctggatgggttcgggcgacgatcgttcatcaactggctagtaccgctcacgatc
atcgtacttgcgctaataggcgcggtctggacagttcatggtgtgctcgctcaccgagac
gaggctgcgcgtgcgcgccgcagtgcgctccatgcgcgaggcgcacacgaaaaggtgttc
gacgaggtgccggcacttgccgagtctgcgtcggccgctgcaatgcccacaccgacgcca
gcaccggccgcggtacagcctgtgccgtccagtgatcgtgctgctccgttacgcagctac
tacgacgcgccgttgctcgccgtgggggcgagcaacgggcaaatggcagacgcgagcgag
agtgagtcagcttcccccagtattttgcccgcgcacgcggaccagcagcagtcgaatgcg
actgccggtatggccgaggagcgggcgaaacccttctcacagccgctgtctcaggcgctc
acgccgacgcgcgtgcccacggtgatagcggcgtttatcggcaaccgcagtttgctactc
gctcagggcacgaagatcgattgcgcgggcgacaccgcgttcgattccacccaggcaggt
atatcgacttgcacggtcgcccgtaatgtctattccgacgacgggcgcgtggtgctgatc
gagcgaggctcgcaaattaattgcgaatatcgcgcgaatctttcacctggacaacgacgt
gtatttgttctgtcagcacgaattgctacaccgcacggtgtcactgtacagatcgattcg
ccggtagccgacgcgctgggccgcatgggtatggatggatcgatcgagaatcactggggc
gcgcgcgtgggcgcggccatgatgctcggactaagtcacgatgcgatcggttatctggcc
acgcgcgggggcaatggcaacggcacgattgtctaccagaacacgcaggcgcaaggcaac
gacatggccacacgcgtactcgatcagaccatcaatattgcgccgacgctcaggcaacat
cagggtaccgagttcacgattgttctggctcgcgatctggatttcagttcggtctatacg
ctggagccggagggagtgcgatga

DBGET integrated database retrieval system