KEGG   Burkholderia orbicola: Bcenmc03_4201
Entry
Bcenmc03_4201     CDS       T00669                                 
Name
(GenBank) type IV secretory pathway VirB3 family protein
  KO
K03198  type IV secretion system protein VirB3
Organism
bcm  Burkholderia orbicola
Pathway
bcm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcenmc03_4201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcm02044]
    Bcenmc03_4201
Secretion system [BR:bcm02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bcenmc03_4201
SSDB
Motif
Pfam: VirB3 DUF3487 PrgI
Other DBs
NCBI-ProteinID: ACA93352
UniProt: B1K7J9
Position
2:complement(1137733..1138053)
AA seq 106 aa
MDTLSDPVFKGCTRPAMLWGVPLVPLLTVGGGMLIPAIWVLMASAALGVAIVLLIVPVFA
TMRMITRQDDQRLAQRMLRAKMRLHQRNRRFWGAHAYAPIRFKARG
NT seq 321 nt   +upstreamnt  +downstreamnt
gtggacacactctctgatcccgtattcaaaggctgcacgcggccagcgatgctatggggc
gttccacttgtaccgctgttgacggtcggtggcggtatgctgatcccggcaatctgggtg
ttgatggcgagtgcggctttgggcgttgcaatcgtactgttgatcgttcccgtgttcgcg
acgatgcgcatgattacgcgtcaggacgaccaacgtctcgctcagcgcatgctacgcgcg
aaaatgagactgcaccagcgcaaccggcgcttctggggcgcgcatgcctatgcgccgatc
cgatttaaggcgcgagggtga

DBGET integrated database retrieval system