KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4977Help
Entry
Bcenmc03_4977     CDS       T00669                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bcm  Burkholderia cenocepacia MC0-3
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Bcenmc03_4977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Bac_export_2
Motif
Other DBs
NCBI-ProteinID: ACA94107
UniProt: B1K5S3
Position
2:complement(2019066..2020658)
Genome map
AA seq 530 aa AA seqDB search
MNQPASSAPNNPGSVARTRQVGYAAFLLVLVLGAVYIATHLVADLAPVREGTLFPYLLLG
AALLIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGMWNFLGVMVSSGAVAFGIL
QLLPVELILQVGSGSGFAMVFALLIAAIVWNLATWYFGLPSSSSHTLIGSIIGVGLMNQL
MHGPSGTSGVDWGQALGVGKSLLLSPIVGFLCASLLLLALKALVRIPELYKEPPKDQPPP
FWIRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPAESQTFVAVA
NQAAATFGKYTNGVAPSANPRADVEHYVQHRELTPAVLPAVAQLSTSLATAVGASGSMAA
VPQRDVDNVRNTMYLVSEAIRLMEKSGQPAFATDDKLAIDNYRKQLDHATKFIPTWVKVA
VAIALGLGTMVGWKRIVVTVGEKIGKQHLTYGQGASAELVAMLTIGAADMYGLPVSTTHV
LSSGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIALAAGLYWLFRSLA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacccgcttcgtccgccccgaacaatccgggctccgtcgcacgcaccagacag
gtcggctatgccgcgttcctgctggtgctcgtgctcggcgccgtctatatcgccacgcac
ctggtcgccgatctggcaccggtccgcgaagggacgctgttcccgtacctgctgctcggc
gccgcactgctgatcgcgctcggcttcgaattcgtcaacggcttccacgacaccgcgaat
gcggtcgcgaccgtgatctatacgcactcgctgacgccgaacgtcgcggtgatctggtcg
ggcatgtggaacttcctcggcgtgatggtctcgagcggcgccgtcgcgttcggcatcctg
cagttgctgccggtcgagctgatcctgcaggtcggcagcggctcgggcttcgcgatggtg
ttcgcgctgctgatcgccgcgatcgtctggaacctcgcgacctggtatttcggattgccg
tcgtcgagctcgcatacgctgatcggatcgatcatcggtgtcgggctgatgaaccagctg
atgcacgggccgtccggcacgagcggggtcgactggggccaggcgctcggcgtcggcaag
tcgctgctgctctcgccgatcgtcgggttcctgtgtgcgtcactgctgctgcttgcgctg
aaggcgctcgtgcggattccggagctgtacaaggagccgccgaaggatcagccgccgccg
ttctggattcgctgcctgctgatcctcacctgcaccggcgtgtcgttcgcgcacgggtcg
aacgacgggcagaaagggatgggcctcatcatgctgatcctgatcggcacggtgccgacc
gcctatgcgctgaacaaggccgtcacgcccgccgaatcgcagaccttcgtggccgtcgcg
aaccaggcggccgcgacgttcgggaagtacacgaacggcgtcgcgccgtccgcgaacccg
cgcgccgatgtcgaacactacgtgcagcatcgtgaactgacacccgccgtgctgccggcc
gtcgcgcagttgtccacgtcgctcgcgaccgccgtcggcgcgtcgggatcgatggcggcc
gtaccgcagcgcgacgtcgacaacgtgcgcaacacgatgtatctggtgtccgaagccatt
cgtctgatggagaagtcgggccagcccgcattcgccaccgatgacaagctcgcgatcgac
aactatcgcaagcagctcgaccacgcgaccaagttcattccgacgtgggtgaaggtggcc
gtcgcgatcgcgctgggcctcggcacgatggtcggctggaagcggatcgtcgtgaccgtc
ggcgaaaaaatcggcaagcagcacctgacgtacggacagggcgcttcggccgaactcgtc
gcgatgctgacgatcggcgccgccgacatgtacggactgcccgtgtcgacgacgcacgtg
ctgtcctcgggtgtcgcgggcacgatggcggcgaacggctccgggctgcaatggagcacc
gtgcgcagcctcgtcctcgcatgggtgctgacgctgccggcatcgatcgcgctggcagca
gggctttactggttgttccggtcgctggcctga

DBGET integrated database retrieval system