KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_5078
Entry
Bcenmc03_5078     CDS       T00669                                 

Definition
(GenBank) catalase/peroxidase HPI
  KO
K03782  catalase-peroxidase [EC:1.11.1.21]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00360  Phenylalanine metabolism
bcm00380  Tryptophan metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Bcenmc03_5078
   00380 Tryptophan metabolism
    Bcenmc03_5078
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.21  catalase-peroxidase
     Bcenmc03_5078
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-ProteinID: ACA94208
UniProt: B1K6I9
Position
2:2150170..2152356
AA seq 728 aa
MSNEGKCPFNHGKRNGTTNRDWWPNQLNLKILHQHSSEADPMDPGFDYAEAFNSLDLAAV
KADLRALMTASQDWWPADFGHYGPFFVRMAWHSAGTYRTGDGRGGAGRGQQRFAPLNSWP
DNVGLDKARRLIWPVKQKYGRKISWADLIVLTGNVALESMGFKTFGFAGGREDSWEPDED
VYWGMESTWLDDKRYSGDRQLETPLAAVQMGLIYVNPEGPNGNPDPLASARDIRETFARM
AMNDEETVALIAGGHTFGKTHGAGDASHVGPEPEAAPLEQMGLGWKSSFGSGKAGDAIGS
GLEVIWTSTPTQWSNNFFWNLFGYDWELTKSPAGAHQWQPKGGAGADSVPDPFEPGKRRV
PTMLTSDIALRADPTYEKISRRFFENPNEFAEAFARAWFKLTHRDMGPRVRYLGPEVPSE
ELLWQDPIPMPDHPQVDEQDVSALKAKVLASGLSVSELVSTAWASASTFRGSDKRGGANG
ARVRLAPQKDWEVNQPAQLATVLEVLGALQVEFNRAATGGKQVSLADLIVIAGNAGVEQA
AAAAGVEITVPFTPGRGDASAEQTDVDSMAVLEPIADGFRNYLKGAYTIPAEKLLIDKAQ
LLSLSAPEMTVLIGGLRVLGTNVGDSKHGVFTDRREVLTNDFFRNLLDMGTEWKPTSEAN
EAYEGRDRATGELKWLASRVDLVFGSHSQLRALSEVYGSEDSQQKFVRDFVAAWTKVMNA
DRFDIKHN
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgtcgaatgagggaaagtgcccgtttaaccatggaaagcgtaacgggacgacgaaccgc
gactggtggccgaaccagttgaacctcaagattttgcaccagcattcgagcgaggcggat
ccgatggatccgggctttgattatgctgaagcattcaatagtctggatctggcggcggtc
aaggccgacctgcgcgcgctgatgacggcatcgcaggactggtggccggcggacttcggt
cactacgggccgtttttcgtgcgcatggcgtggcatagtgccggcacataccggacgggg
gatggccgcggtggtgcagggcgaggtcaacagcgattcgcaccactgaatagttggcca
gacaacgtcgggctggacaaggcccggcgattgatctggccggtcaagcagaaatacgga
cgcaagatttcgtgggcggacctgatcgtactgactggcaacgtggcgctggaatcgatg
ggcttcaagacgttcggcttcgcgggcggccgggaagactcgtgggagccggacgaggac
gtttactggggcatggaatcgacctggctggacgacaagcgctacagcggcgatcgtcag
ctcgagacgccgctggcggcagtgcagatggggctgatctatgtgaacccggaaggcccg
aacggcaaccccgacccgttggcgtcggcgcgcgacatccgtgagaccttcgcacgcatg
gcgatgaacgatgaggaaaccgtcgccctgatcgcgggcggccacacgttcggcaagacc
cacggtgcgggtgatgcgtcgcacgtcgggcctgagcccgaagcggcaccgctcgaacag
atggggctgggctggaagagttcgttcgggtcaggcaaggcgggcgatgcgatcggcagc
ggcctcgaggtgatctggacgtcgacgccgacgcagtggagcaacaatttcttctggaat
ctattcggctacgactgggagctaacgaagagtccggctggcgcgcatcagtggcagccg
aagggcggcgccggtgcggacagtgtgccggatccgtttgaaccgggcaaacgccgtgta
ccgacgatgctgacctcggatattgcgctgcgtgccgacccgacttacgagaagatctcg
cgccgcttcttcgagaatccgaacgagttcgccgaggcattcgcgcgcgcgtggttcaag
ctgacgcaccgtgacatggggccgcgcgtgcgttatctgggtccggaagtgcccagcgag
gaattgctgtggcaggatccgattccgatgccggatcatccccaggtagacgaacaggat
gtgagcgcgctgaaagccaaggtgctcgcatcgggtctgtcggtctcagaactggtctcc
actgcgtgggcgtcggcttcgacgttccgcggttcggacaagcgcggcggagcgaacggc
gcgcgtgtgcgtctcgcgccacagaaggactgggaagtgaaccagccggcgcaactggcc
acggtgctggaggtgctgggcgcgctgcaggtggaattcaaccgtgcggccacgggcggc
aagcaggtttcgctggccgacctgatcgtgatcgcggggaatgcgggtgtcgagcaggcc
gcagcagcagccggggtcgagatcacggtgccgttcacgccggggcgcggcgacgcaagc
gccgagcagacggatgtcgattcgatggcggttctcgagccgatcgctgacggcttccgc
aactacctgaaaggtgcttatacgatcccggcagagaagttgctgatcgacaaggcgcaa
ctgctttcgctatcggcgccggagatgacggtgctgatcggtggcctgcgcgtgctcggc
acgaacgtgggcgattcgaagcacggcgtgttcacggaccgtcgcgaagtgctgaccaac
gactttttccgcaatctgctcgacatgggcacggagtggaagccgacctcggaggccaac
gaagcctatgaaggtcgggatcgtgcgacgggcgagctcaagtggctggcctcgcgtgtc
gacctagtgttcggttcgcattcgcaactgcgcgcgctgtcggaagtgtacggcagcgag
gattcgcagcagaagttcgtgcgtgacttcgttgccgcgtggacgaaggtgatgaacgcc
gatcgtttcgatatcaagcacaattaa

DBGET integrated database retrieval system