KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_5415Help
Entry
Bcenmc03_5415     CDS       T00669                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00430  Taurine and hypotaurine metabolism
bcm00620  Pyruvate metabolism
bcm00640  Propanoate metabolism
bcm00680  Methane metabolism
bcm01100  Metabolic pathways
bcm01120  Microbial metabolism in diverse environments
bcm01200  Carbon metabolism
Module
bcm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcenmc03_5415
   00640 Propanoate metabolism
    Bcenmc03_5415
  09102 Energy metabolism
   00680 Methane metabolism
    Bcenmc03_5415
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Bcenmc03_5415
Enzymes [BR:bcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Bcenmc03_5415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ACA94542
UniProt: B1K8J2
Position
2:2536940..2538148
Genome map
AA seq 402 aa AA seqDB search
MRHPVLVLNAGSSSLKFSVYDTREDRSLDAGLHGQVENLHDTPHLFVTDAEGATLADSAV
ARPGHQGAIEALHAWFAAHVGREAAFDGVGHRVVHGGPYFTAPVRIDARVLDAIASLAPL
APLHQPHHVDAIRAVAAVAPNLPQVACFDTAFHATVPALEREFALPRALTEQGIVRYGFH
GLSYEYIATALAALDPSWMQHRTVVAHLGNGASLCALANGRSVATTMGFTAVDGLPMGTR
TGALDPGVILYLQRHTGRSLDEVEHLIYAESGLLGVSGVSSDMRTLLASDAPSAAHAVEL
FAYRAARELAALAGVLGGLDTLVFTAGIGEHAPRVRERICRRAAWLGIVLDDAANAAGLP
VISSDASRVTVRVIPTDENLMIARHTRRVLDDAIPSTPYPTR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctgtcctggtgctcaacgccggctcgtcgagcctcaagttttcggtctac
gacacgcgagaggatcgttcgctcgatgcgggcctgcacgggcaggtcgagaacctgcat
gacaccccgcatctgttcgtgaccgatgcagagggcgcgacgctcgccgacagcgccgtc
gcgcgaccggggcatcaaggcgcgatcgaggcgctgcacgcatggttcgccgcgcacgtc
gggcgggaggccgcgttcgacggcgtcgggcaccgcgtcgtgcatggcggcccgtatttc
accgcgccggtgcggatcgatgcgcgcgtgctcgatgcgatcgcgtcgcttgcaccgctc
gcgccgctgcaccagccgcaccacgtcgacgcgattcgcgcggttgccgcggttgcgccg
aacctgccgcaggtcgcgtgtttcgacaccgcgttccatgcgacggtgccggcgctcgaa
cgggagttcgcgttgccgcgcgcgctgaccgagcagggcatcgtgcgctacgggtttcac
gggctgtcgtacgagtacatcgcgacggcgctcgcggccctcgatccgtcgtggatgcag
caccggacggtggtcgcgcacctcggtaacggcgcaagcctgtgtgcgctcgcgaacggc
cgcagcgtcgcgacgacgatggggttcacggccgtcgacgggctgccgatgggcacgcgc
acgggcgcgctggaccccggcgtgatcctgtacctgcagcgtcacacgggccgctcgctc
gacgaggtcgagcatctgatctatgccgaatcgggcttgctgggcgtgtcgggcgtgtcg
agcgacatgcgcacgctgctcgcgagcgacgcaccgtcggccgcgcatgcggtcgagctg
ttcgcctatcgcgcggcccgcgaactcgccgcactggccggcgtgctcggcggtctcgac
acgctcgtgttcacggcgggcatcggcgagcacgcgccgcgcgtgcgtgaacggatctgc
cgccgcgcggcgtggctcggcatcgtgctcgacgacgcggcgaacgcggccggcctgccg
gtgatttcgagcgacgcgtcgcgcgtgacggtgcgcgtgatcccgaccgacgagaacctg
atgatcgcgcgccacacgcgccgcgtgctggacgacgcgattccctccacgccgtatccg
acccggtga

DBGET integrated database retrieval system