KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6008Help
Entry
Bcenmc03_6008     CDS       T00669                                 

Definition
(GenBank) Phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00562  Inositol phosphate metabolism
bcm00564  Glycerophospholipid metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bcenmc03_6008
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcenmc03_6008
   00565 Ether lipid metabolism
    Bcenmc03_6008
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bcenmc03_6008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bcm02042]
    Bcenmc03_6008
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Bcenmc03_6008
Bacterial toxins [BR:bcm02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Bcenmc03_6008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: ACA95129
UniProt: B1K5U7
Position
2:3205320..3206993
Genome map
AA seq 557 aa AA seqDB search
MFRQALLVTACAGATLALFACGGSDDSTPAPVVSSQDALQTATPIKHVVVIYGENISFDH
YFGTYPNATNPSGEPAFTAKSGTPTPNGLTGTLLTANPNFTNTANGTDAANPFRLDRTQA
ATADQNHAYTAEQQAEDNGLADLFPKYTGKGSSGGAGAFGTKGQVMGYFDGNTVTALWNY
AQRFAMSDNTFTTVYGPSTPGALNVVAGQTNGMQIVKTSKQPSTLAASSYYINDGQGGLT
MINDVDPGFDVCSSTTDQAMMTGKNIGDLLNAAKITWGGFMGGFNLSTTNGNGTTGCARS
TVATAVNAATADYIPHHNWFQYYASTANPQHTRPSSIAAIGSSVQTDGKTAEPANHQYDT
DDFFAAVKAGNFPSVSYLKAPAAQDGHAGYSDPLDEQAFVTKVVNFLQQQPDWQNTAVIV
TYDDSDGWYDHVYTAPTHASSDPVDQLNGAGKCGTGGTTGVNGATVNGRCGPGVRIPLVV
ISPYAKQNYVDHTMLDQSSVVRFIEDNWLGGQRIGGGSFDATAGDLRNLFDFTSKPNTTP
LYLDPTLGTALSAAPAI
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtcaagccttgcttgtcaccgcctgcgccggcgccacgcttgcgctgttcgcc
tgcggcggcagcgacgattccacaccggcgcccgtcgtctcgtcgcaggatgcgcttcag
accgccacgccgatcaagcacgtcgtcgtgatctacggcgaaaacatctcgttcgaccac
tacttcggcacctacccgaacgcgacgaacccgtcgggcgaaccggcgttcaccgccaaa
tccggcacgccgacgccgaacggcctgacgggcacgctgctcaccgcgaacccgaacttc
acgaacacggccaacggcaccgacgcggcgaacccgttccgcctcgaccgcacgcaggcc
gcgaccgccgaccagaaccacgcgtacacggccgaacagcaggccgaggacaacggcctc
gccgacctgttcccgaagtacaccggcaagggctcgtccggcggcgccggcgcgttcggc
acgaagggccaggtgatgggctacttcgacggcaacacggtgaccgcgctgtggaactac
gcgcagcgcttcgcgatgagcgacaacacgttcacgacggtctacgggccgtcgacgccc
ggcgcgctgaacgtcgtcgcgggccagaccaacgggatgcagatcgtcaagacgtcgaag
cagccgtcgacgctcgccgccagctcgtactacatcaatgacggccagggcggcctcacg
atgatcaacgacgtcgatccgggcttcgacgtgtgctcgagcacgaccgaccaggcgatg
atgaccggcaagaacatcggcgacctgctgaatgccgcgaagatcacgtggggcggcttc
atgggcggcttcaacctgtcgacgacgaacggcaacggcacgacgggctgcgcgcgcagc
acggtcgctaccgccgtgaacgccgcgacggccgactacatcccgcaccacaactggttc
cagtactacgcgtcgaccgcgaacccgcaacacacgcgcccgagctcgatcgcggcgatc
ggttcgagcgtccagaccgacggcaagactgccgaaccggcgaaccaccagtacgacacc
gacgacttcttcgccgccgtgaaggccggcaacttcccgtcggtcagctacctgaaggcg
ccggccgcgcaggacgggcatgcgggctattcggatccgctcgacgagcaggcgttcgtg
acgaaggtcgtcaacttcctgcagcagcagccggactggcagaacacggccgtgatcgtc
acctatgacgactcggacggctggtacgaccacgtgtacacggcgccgacgcacgcgtcg
tcggacccggtcgaccagctcaacggcgccggcaaatgcggcacgggcggcaccaccggc
gtgaacggcgcgaccgtgaacggccgctgcggcccgggcgtgcgtattccgctggtcgtg
atctcgccgtatgcgaagcagaactacgtcgatcacacgatgctcgaccagtcgtccgtc
gtgcgcttcatcgaggacaactggctcggcggccagcggatcggcggcggttcgttcgat
gcgacggccggcgacctgcgcaacctgttcgacttcacgtcgaagccgaacacgacgccg
ctgtatctcgacccgacgctcggcaccgcgttgagcgcggccccggcgatctga

DBGET integrated database retrieval system