KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6331Help
Entry
Bcenmc03_6331     CDS       T00669                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00010  Glycolysis / Gluconeogenesis
bcm00052  Galactose metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_6331
   00052 Galactose metabolism
    Bcenmc03_6331
Enzymes [BR:bcm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bcenmc03_6331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACA95446
UniProt: B1KB49
Position
3:344878..345966
Genome map
AA seq 362 aa AA seqDB search
MHIDTDSSYLTPGAARVLSEPWGTLPDGEPVRRYTLRNVHGMRVVVSDLGATVVSWLAPD
RTGRLADIVLAHDTPAEYLESGAYLGATVGRWANRIAGAHFTLDGVDYLLDRNENGNLLH
GGANGFHRARWDVLDDGGGLTLQLDSPEGDAGFPGNVRVQVRYTLDDDGTLTIDYSGWTD
APTPLNLTNHSYFNLNGRAGSDVRGHLLHIDADAFLEVDDALIPTGTADVTGTAFDFRQS
APLGARLDWPHAQLARARGFDHCYVVDNGAREVRPVARIYDPESGRELIVSTDQRGLQLY
TGNYLDGLRVSGGTRCVPHAALCVEAGGFPDQVNMDGLRDDVIVRPGDVYRQTTRYRVAV
QA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcgataccgattcctcatacctgacgcccggcgcggcacgcgtgctttccgag
ccgtggggcacgttgcccgacggcgagcccgtgcgacgctatacgctgcgcaacgtgcac
ggaatgcgcgtcgtcgtcagcgacctcggcgcgaccgtcgtgtcgtggctcgcgcccgat
cgcaccgggcgcctggccgatatcgtgctcgcgcacgacacgccggccgagtacctcgaa
tccggcgcctatctcggcgcgacggtcggccgctgggcgaaccggatcgccggcgcgcac
ttcacgctcgacggcgtcgactacctgctcgaccgcaacgagaacggcaacctgctgcac
ggcggcgcgaacggttttcatcgcgcgcggtgggacgtgctcgacgatggcggcgggctg
acgctgcaactcgattcgccggaaggcgacgcgggattccccggcaacgtgcgcgtgcag
gtgcgctacacgctcgacgacgacggcacgctgacgatcgactattcggggtggaccgat
gcgccgacgccgctgaacctgacgaatcacagttacttcaacctgaacgggcgcgcgggc
agcgacgtgcgcggccatctgctgcacatcgacgccgatgcattcctcgaagtggacgac
gcgctgatcccgaccggcacggccgacgtgacgggcacggccttcgatttccggcaaagc
gcgccgctcggcgcgcgcctcgactggccgcatgcgcaactggcgcgggcgcgcggcttc
gatcactgctacgtcgtcgacaacggcgcgcgcgaggtccggcccgtcgcacgaatctac
gatccggaaagcggccgcgagctgatcgtgtcgaccgatcagcgcgggctgcaactctat
acgggcaactatctcgacggcctgcgcgtgagcggcggcacgcgctgcgtgccacacgcg
gcgctgtgcgtcgaggcgggaggctttccggatcaggtcaacatggacggcctgcgcgac
gacgtgatcgttcgtccaggcgacgtgtaccgacagaccacgcggtatcgggtcgccgtt
caggcatag

DBGET integrated database retrieval system