KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6898Help
Entry
Bcenmc03_6898     CDS       T00669                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00071  Fatty acid degradation
bcm00072  Synthesis and degradation of ketone bodies
bcm00280  Valine, leucine and isoleucine degradation
bcm00310  Lysine degradation
bcm00362  Benzoate degradation
bcm00380  Tryptophan metabolism
bcm00620  Pyruvate metabolism
bcm00630  Glyoxylate and dicarboxylate metabolism
bcm00640  Propanoate metabolism
bcm00650  Butanoate metabolism
bcm00900  Terpenoid backbone biosynthesis
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
bcm01212  Fatty acid metabolism
bcm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcenmc03_6898
   00630 Glyoxylate and dicarboxylate metabolism
    Bcenmc03_6898
   00640 Propanoate metabolism
    Bcenmc03_6898
   00650 Butanoate metabolism
    Bcenmc03_6898
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcenmc03_6898
   00072 Synthesis and degradation of ketone bodies
    Bcenmc03_6898
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcenmc03_6898
   00310 Lysine degradation
    Bcenmc03_6898
   00380 Tryptophan metabolism
    Bcenmc03_6898
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcenmc03_6898
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcenmc03_6898
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcenmc03_6898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcm04147]
    Bcenmc03_6898
Enzymes [BR:bcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcenmc03_6898
Exosome [BR:bcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcenmc03_6898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACA96001
UniProt: B1KCQ4
Position
3:complement(999343..1000539)
Genome map
AA seq 398 aa AA seqDB search
MKRAAIVSPVRTPVGAFGGSLRGVSVEALGALVANETIRRAGLDPARIDDVVFAQSYANS
ETPCVGRWIALQAGLPVEVPGMQLDRRCGGGLQALATAAMMVQTGAADVVLAGGVESMSN
IEYYSTDMRWGARSGSVQFHDRLARGRERSQPESRFGYISGMIETAENLATDYGISREAA
DEFALHSHRRAAAAWESGRMADEVVSVTVPQKKGEPLLFSRDEGFRADASMESLGKLRAL
MPGGTVTAGNSSQQNDAAAACLVVSEDRLEALGLEPMAWFTGWAAAGCEPSRMGIGPVPA
VQKLMARTGLSLDQMDLVEVNEAFACQVLAVLKGWNWHDTDRLNVNGSGISLGHPIGATG
VRIMTTLLHELTRRKGRYALETMCIGGGQGIAAVFERA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgcagccattgtctcccctgtacgaacgcccgtcggcgcctttggcggaagc
ctgcgcggcgtatccgtcgaagcactcggagcactcgttgcgaacgaaaccatccggcga
gcgggactcgatcccgcccgcatcgacgacgtcgttttcgcacaatcgtatgcgaacagc
gaaacgccctgcgtgggccgctggatcgcgttgcaggcaggccttcccgtggaagtgccg
ggcatgcaactcgaccggcgctgtggcggcggcctgcaggcactggccaccgccgcaatg
atggtccagacgggcgccgccgacgtggttctggcgggcggcgtggaaagcatgagcaat
atcgagtactacagtacggacatgcgctggggtgcccgttcgggctccgtgcagtttcac
gaccgcctggcacgcggccgcgagcgctcgcagcccgaatcgcgtttcggctacatctcg
ggcatgatcgaaacggcggaaaatctcgccaccgactacggcatcagccgcgaagccgca
gacgaattcgcactgcacagccatcggcgcgcggcggcagcatgggagtcgggccgtatg
gccgacgaggtcgtgtccgtcaccgttccgcagaagaaaggcgagcccctcctcttctcc
agagatgaaggattccgcgccgacgccagcatggaaagcctcggcaagcttcgcgcgttg
atgccgggcggcaccgtcaccgcgggcaactccagccagcagaacgacgccgcggctgcg
tgcctcgtcgtctcggaggatcgcctcgaagcgctagggctcgaacccatggcgtggttc
accggctgggctgccgccggctgcgagccatcgcgcatgggcatcggacccgtgcctgcg
gtccagaagctcatggcacgcaccggcctgtcgctcgaccagatggatctcgtcgaagta
aacgaagcgttcgcatgccaggtgctggccgttctcaaaggctggaactggcacgacacc
gaccggctgaacgtgaacggctccggcatctcgctcggccaccccatcggcgccacgggc
gtgcgcatcatgacgacgctcctgcacgaactgacgcgtcgaaaggggcgttatgcactc
gagaccatgtgcatcggcggcggccaaggtattgccgccgtattcgagcgcgcctga

DBGET integrated database retrieval system